DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnk15

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_005161945.1 Gene:kcnk15 / 100000132 ZFINID:ZDB-GENE-080220-30 Length:357 Species:Danio rerio


Alignment Length:284 Identity:81/284 - (28%)
Similarity:121/284 - (42%) Gaps:58/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNLDE 124
            |..:..:.|::.:..|..||..:|..||...|            :.|:|.|..  ...|:.....
Zfish     3 KQNVRTLSLILCIFSYLLVGAAVFVALESDTE------------SARKRMLEH--KRAELRRKYR 53

  Fly   125 LLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYE---RWSILQAVFFSSTVLTTIGYGNIVPVTT 186
            ....:..:.|..::||              ||:.   :|....:.:|:.||:||||||:..|.|.
Zfish    54 FTDGDYQELERVLRQA--------------EPHRAGTQWRFAGSFYFAITVITTIGYGHAAPGTD 104

  Fly   187 GGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFGKHMP-------TKPKFTNFIGKTWFYAIL 244
            .|::||:.:|.:|||.||.:....|....|.|......|.       |:....|.:         
Zfish   105 AGKLFCMLYAGLGIPLTLVMFQSLGERMNTGVRFLLSRMKRALGLQRTEISTQNMV--------- 160

  Fly   245 AVGFLGVY--LAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLV--PKKPN------YMLLC 299
            .||.|...  |..||.....:| .||||..:|:||||:|||||||.|  .||.:      |:|..
Zfish   161 LVGVLSCLGTLCVGAAAFSHFE-SWTFFHAYYYCFITLTTIGFGDFVALQKKEDLQENQPYVLFS 224

  Fly   300 TLYILIGLALTSTIIELVRRQYAT 323
            .:|||:||.:....:.||..::.|
Zfish   225 FIYILLGLTVIGAFLNLVVLRFLT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 22/59 (37%)
Ion_trans <240..314 CDD:278921 33/83 (40%)
Ion_trans_2 <266..319 CDD:285168 28/60 (47%)
kcnk15XP_005161945.1 Ion_trans_2 <77..132 CDD:285168 22/54 (41%)
Ion_trans_2 167..243 CDD:285168 31/76 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.