DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sk1 and TIM54

DIOPT Version :9

Sequence 1:NP_572717.1 Gene:Sk1 / 32089 FlyBaseID:FBgn0030300 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_012481.3 Gene:TIM54 / 853392 SGDID:S000003590 Length:478 Species:Saccharomyces cerevisiae


Alignment Length:288 Identity:54/288 - (18%)
Similarity:95/288 - (32%) Gaps:99/288 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 GKGKKEPPVEAARELPAESTAAGIRSSLPLN------------------------------AGEF 427
            |:..|||....|:  |:.|:.:.|.|.||.|                              .|.|
Yeast   153 GQPVKEPNQTVAK--PSGSSTSKISSLLPFNKIIQDPAEEDDSFDPEIGKKFKENFDWRNVIGIF 215

  Fly   428 HDLPEEEE--------GEAVLDGEQFADAISLDRSVYRQHADSWHSAMSRRTAYYSLGGPSMRSN 484
            :.:|:.:.        .:.:|.|    ..|.|.|..|:::....|.         .|.||..::.
Yeast   216 YTMPKPKHIISEDALTKDPILSG----GVICLGRGAYKEYIAGIHE---------GLLGPIEKTE 267

  Fly   485 RSRMSISQRIEAANAEFAERVPTGTIPPLQMPLLSSDGWICEDGDFVMVHAAYTTHL-----SSD 544
            ::..:             |...||.:...|:     :..:.|.|...:|.|...|.|     ..|
Yeast   268 KTGST-------------EPKMTGVVEANQI-----ESKVSESGATELVDAEKETALEEAKVQDD 314

  Fly   545 VFFAPESRLDDGLIYLVIIRRGVSRHQLLNFMLNLNAGTHLPIGEDPFIKVVPCRAFRIEPSSSD 609
            :....|:..:|...:|   :..:|..|..:  |.:.:....|.||  ||:         .|:::.
Yeast   315 LKVDEENSSEDSQKFL---KPFISSDQYPD--LQIASELQTPNGE--FIR---------NPNTNI 363

  Fly   610 GILVVDGERVEYGPIQAEVMPGLINVMT 637
            .:|:..       |:....:|.||...|
Yeast   364 PLLINQ-------PLLVIPIPNLIGFTT 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sk1NP_572717.1 PLN02958 <189..622 CDD:215517 49/271 (18%)
DAGK_cat 191..330 CDD:279163
TIM54NP_012481.3 Tim54 20..466 CDD:403038 54/288 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12358
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.