DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sk1 and tim54

DIOPT Version :9

Sequence 1:NP_572717.1 Gene:Sk1 / 32089 FlyBaseID:FBgn0030300 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_596696.1 Gene:tim54 / 2540096 PomBaseID:SPBC1347.04 Length:347 Species:Schizosaccharomyces pombe


Alignment Length:190 Identity:33/190 - (17%)
Similarity:68/190 - (35%) Gaps:71/190 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 SPADCGKQLLILLNPKSGSG--KGRELFQKQVAPLLTEAEVQYDLQITTHPQYAKEFVRTRRDLL 245
            :|.:..::|.:.|:...|.|  ..||.|::.:.|:...|.::::                     
pombe    55 APLELPRKLKVYLHGPPGDGIYVAREEFEEYIRPIFNAAAIEFE--------------------- 98

  Fly   246 TRYSGIVVASGDGLFYEVLNGLMERMDWRRACRELPLGIIPCGSGNGLAKSV---AHHCNEPYEP 307
                 .|.:.|:|       .|:|:                      :|::|   .|:.:|..||
pombe    99 -----TVESKGEG-------NLLEQ----------------------VARTVYNKRHNISEVSEP 129

  Fly   308 KPILHATLTCMAGKSTPMDVVRVELATRDKHFVMYSFLSVGWGLIADI---DIESERLRS 364
            :..|   |:.:.....|..:|.:     .:|.:......|.:|...||   .:|:|:|.:
pombe   130 EKNL---LSVLKPSVDPPAIVLL-----GRHALKEFLYGVRYGFSDDIMKRKLETEKLEA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sk1NP_572717.1 PLN02958 <189..622 CDD:215517 32/184 (17%)
DAGK_cat 191..330 CDD:279163 24/143 (17%)
tim54NP_596696.1 Tim54 10..323 CDD:288548 33/190 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12358
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.