DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Evi5 and PAM1

DIOPT Version :9

Sequence 1:NP_727526.2 Gene:Evi5 / 32088 FlyBaseID:FBgn0262740 Length:807 Species:Drosophila melanogaster
Sequence 2:NP_197097.1 Gene:PAM1 / 831450 AraportID:AT5G15930 Length:356 Species:Arabidopsis thaliana


Alignment Length:344 Identity:124/344 - (36%)
Similarity:196/344 - (56%) Gaps:29/344 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LNSLHSTHSRKNSDTSQISLTSSGNSVAEEDIWTTWATIL----NDWEGALKRKNPCVSELVRRG 116
            |...|.:..::.:.|.     ||.|...||...|.|..::    :||:..::||...|...:|:|
plant    26 LKQEHGSSPQRFTKTK-----SSINYEKEEKRVTKWRKMIGTGGSDWKHYVRRKPHVVKRRIRKG 85

  Fly   117 IPHHFRAIVWQQLSGASD------GDKKQYAEYIKATSACEKVIRRDIARTYPEVEFFKEKDGPG 175
            ||...|.:|||.:||:.|      |...|...|  .|||.|..|.|||:||:|...||:::.|||
plant    86 IPDCLRGLVWQLISGSRDLLLMNPGVYVQLVIY--ETSASELDIIRDISRTFPSHVFFQKRHGPG 148

  Fly   176 QEALFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMPEEEAFAVLVQIMQ---QHRMRHMFKPSMS 237
            |.:|:||:||||::||:|||.||.|||.||||:.|.||:||.:||.:::   ...:..:::..:.
plant   149 QRSLYNVLKAYSVYDRDVGYVQGMGFIAGLLLLYMSEEDAFWLLVALLKGAVHSPIEGLYQAGLP 213

  Fly   238 ELGLCMYQLENLVQEQIPDMHIHFQQQGFQTTMYASSWFLTLYTTTLNVNLSCRIMDVFLSEGME 302
            .:...:.|.:.||:|.:|.:..||.|:....:||||.||:|:::.:|..:.:.||.||||:||::
plant   214 LVQQYLLQFDQLVRELMPKLGEHFTQEMINPSMYASQWFITVFSYSLPFHSALRIWDVFLAEGVK 278

  Fly   303 FIFKVALALLLTGKDTLLCLDMEAM---LKFFQKELPGRVEADVEGFFNLAYSIKLNTKRMKKME 364
            .:|||.||||....|.||.|..|.:   |:.|.::     ..|.:....||||||: :||:::|:
plant   279 IVFKVGLALLKHCHDDLLKLPFEELMHALRNFPED-----AMDPDTLLPLAYSIKV-SKRLEEMK 337

  Fly   365 KEYQDLKKKEQEEMAELRR 383
            ::......|..:....:|:
plant   338 QDCDKAVAKPTQTAKSVRQ 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Evi5NP_727526.2 TBC 113..320 CDD:214540 91/215 (42%)
DUF4527 627..>731 CDD:291689
PAM1NP_197097.1 TBC 82..296 CDD:214540 91/215 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 168 1.000 Domainoid score I1178
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H121902
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1084
orthoMCL 1 0.900 - - OOG6_101755
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.770

Return to query results.
Submit another query.