DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Evi5 and AT3G02460

DIOPT Version :9

Sequence 1:NP_727526.2 Gene:Evi5 / 32088 FlyBaseID:FBgn0262740 Length:807 Species:Drosophila melanogaster
Sequence 2:NP_566172.1 Gene:AT3G02460 / 821261 AraportID:AT3G02460 Length:353 Species:Arabidopsis thaliana


Alignment Length:331 Identity:128/331 - (38%)
Similarity:193/331 - (58%) Gaps:24/331 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LHSTHSRKNSDTSQISLTSSGNSVAEEDIWTTWATIL----NDWEGALKRKNPCVSELVRRGIPH 119
            |...|:......|:...|||.:...||.....|..::    :||:..::||...|...:|:|||.
plant    27 LKQEHANSPERFSKSKTTSSTDHDREERKVRKWRKMIGVGGSDWKHYVRRKPNVVRRRIRKGIPD 91

  Fly   120 HFRAIVWQQLSGASD------GDKKQYAEYIKATSACEKVIRRDIARTYPEVEFFKEKDGPGQEA 178
            ..|.:|||.:||:.|      |..:|...|  .|||.|..|.|||:||:|...||:::.||||.:
plant    92 CLRGLVWQLISGSRDLLLMNPGVYEQLVIY--ETSASELDIIRDISRTFPSHVFFQKRHGPGQRS 154

  Fly   179 LFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMPEEEAFAVLVQIMQ---QHRMRHMFKPSMSELG 240
            |:||:||||::||:|||.||.|||.||||:.|.||:||.:||.:::   ...|..::...:..:.
plant   155 LYNVLKAYSVYDRDVGYVQGMGFIAGLLLLYMSEEDAFWLLVALLKGAVHAPMEGLYHAGLPLVQ 219

  Fly   241 LCMYQLENLVQEQIPDMHIHFQQQGFQTTMYASSWFLTLYTTTLNVNLSCRIMDVFLSEGMEFIF 305
            ..::|||:||:|.||.:..||.|:....:||||.||:|:::.:....|:.||.|||||||::.:|
plant   220 QYLFQLESLVKELIPKLGEHFTQEMINPSMYASQWFITVFSYSFPFPLALRIWDVFLSEGVKIVF 284

  Fly   306 KVALALLLTGKDTLLCLDMEAM---LKFFQKELPGRVEADVEGFFNLAYSIKLNTKRMKKMEKEY 367
            ||.||||...:|.|:.|..|.:   ||.|.::     ..:.:....||||||: :||::::..||
plant   285 KVGLALLKYCQDELVKLPFEKLIHALKTFPED-----AMNPDTLLPLAYSIKV-SKRLEELTLEY 343

  Fly   368 QDLKKK 373
            |....|
plant   344 QKTNAK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Evi5NP_727526.2 TBC 113..320 CDD:214540 96/215 (45%)
DUF4527 627..>731 CDD:291689
AT3G02460NP_566172.1 TBC 85..299 CDD:214540 96/215 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 168 1.000 Domainoid score I1178
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H121902
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000497
OrthoInspector 1 1.000 - - mtm1084
orthoMCL 1 0.900 - - OOG6_101755
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1412
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.770

Return to query results.
Submit another query.