DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Evi5 and CG5916

DIOPT Version :9

Sequence 1:NP_727526.2 Gene:Evi5 / 32088 FlyBaseID:FBgn0262740 Length:807 Species:Drosophila melanogaster
Sequence 2:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster


Alignment Length:290 Identity:78/290 - (26%)
Similarity:145/290 - (50%) Gaps:34/290 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 WEGALKRKNPC------VSELVRRGIPHHFRAIVWQQLSGASDGDKKQ---YAEYIKATSACEKV 153
            ||..|::....      :...:|:|||..:|..||.::|||:...::.   :...::.....:::
  Fly    46 WEAILQQNTDLTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEI 110

  Fly   154 ---IRRDIARTYPEVEFFKEKDGPGQEALFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMPEEE- 214
               |..|:.||:|:...|..|    ::.|:|::.||:.|:|:||||||..:|.||||:...:|| 
  Fly   111 SDSISIDLPRTFPDNIHFDMK----KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEK 171

  Fly   215 AFAVLVQIMQ-------QHRMRHMFKPSMSELGLCMYQLENLVQEQIPDMHIHFQQQGFQTTMYA 272
            :|.:|..|::       .|.|.::.:      .|.:::  .||..:||.::.|....|....:.|
  Fly   172 SFWLLKHIVENIVPQYHSHNMANLLR------DLAVFR--ELVIRRIPAVNRHVDNLGLPYPVIA 228

  Fly   273 SSWFLTLYTTTLNVNLSCRIMDVFLSEGMEFIFKVALALLLTGKDTLL-CLDMEAMLKFFQKE-L 335
            |.||:.::...|.|....||.|...:||.:.:|:.||.:.:|.|:.:| |.|:.|:...|:.. :
  Fly   229 SKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMI 293

  Fly   336 PGRVEADVEGFFNLAYSIKLNTKRMKKMEK 365
            ...:..|..||....:|::|....::.:.|
  Fly   294 QDNIVTDCHGFVEAMFSLRLKRSELESLRK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Evi5NP_727526.2 TBC 113..320 CDD:214540 64/220 (29%)
DUF4527 627..>731 CDD:291689
CG5916NP_001287357.1 TBC 67..276 CDD:214540 64/220 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.