DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Evi5 and GAPsec

DIOPT Version :9

Sequence 1:NP_727526.2 Gene:Evi5 / 32088 FlyBaseID:FBgn0262740 Length:807 Species:Drosophila melanogaster
Sequence 2:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster


Alignment Length:312 Identity:64/312 - (20%)
Similarity:117/312 - (37%) Gaps:66/312 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 DTSQISLTSSGNSVAEEDIWTTWATILNDWEGALKRKNPCVSELVRRGIPHHFRAIVWQQ----- 128
            |:..:.|.....|...|..|.|:   .||.|..|:     :.:.|||..|.   ...:||     
  Fly   100 DSGGVGLQDHPLSEGPESAWNTF---FNDNEFLLQ-----IDKDVRRLCPD---ISFFQQPTDYP 153

  Fly   129 ----LSGASDGDKKQYAEYIKATSACEKVIRRDIART------------YPEVEFFKEKDGPGQE 177
                :....:..::.:...:.|..:...|.|:.:..|            |..:|       .|||
  Fly   154 CEIVVHSKGEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAME-------EGQE 211

  Fly   178 ALFNVIK----AYSLHDREVGYCQGSGFIVGLLLMQM-----------PEEEAFAVLVQIMQQHR 227
            |.:.|::    .|:..:...||.||...|||.:...|           .|.:.|.....:|.:  
  Fly   212 AHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSE-- 274

  Fly   228 MRHMFKPSMSE----LGLCMYQLENLVQEQIPDMHIH--FQQQGFQTTMYASSWFLTLYTTTLNV 286
            :|..|..::.:    :...|.:|.|:::.:  |:.|:  .:.|......|:..|...|.:....:
  Fly   275 IRDFFIKTLDDAEGGIKFMMARLSNMLKSK--DLSIYELLRSQELHPQYYSFRWLTLLLSQEFPL 337

  Fly   287 NLSCRIMD-VFLSE-GMEFIFKVALALLLTGKDTLLCLDMEAMLKFFQKELP 336
            ....||.| ||..| ..:|:.|:..:::|..::.:|..|..:.:|..|...|
  Fly   338 PDVLRIWDSVFADEQRFDFLIKICCSMILIQREAILENDFASNVKLLQNYPP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Evi5NP_727526.2 TBC 113..320 CDD:214540 49/250 (20%)
DUF4527 627..>731 CDD:291689
GAPsecNP_648245.2 TBC <191..373 CDD:214540 39/192 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456581
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.