DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Evi5 and TBC1D16

DIOPT Version :9

Sequence 1:NP_727526.2 Gene:Evi5 / 32088 FlyBaseID:FBgn0262740 Length:807 Species:Drosophila melanogaster
Sequence 2:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster


Alignment Length:363 Identity:71/363 - (19%)
Similarity:136/363 - (37%) Gaps:74/363 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TSEMDLLAKLEAANKLIESDAKSLNS----LHSTHSRKNSDTSQI-----------------SLT 76
            ||...::|..|:..|::......|:.    ||..|...::.||:.                 .:.
  Fly   280 TSGQLVIASRESQYKILHFHYGGLDHLAQVLHQWHCFLHNITSETGQDKFDLPYRHFMVCRPEVK 344

  Fly    77 SSGNSVAEEDI--WTT---WATILNDWEGALKRKNPCVSELVRR------GIPHHFRAIVWQQL- 129
            .|.....|.|:  .||   :.|:||:       |.....:|:.|      |:....|..||..| 
  Fly   345 KSEMHPDEGDVKKITTNFFYGTLLNE-------KGQIEDDLLLRKCVFFGGLEKSLRKTVWPFLL 402

  Fly   130 ---SGAS---------DGDKKQYAE-------------YIKATSACEKVIRRDIARTYPEVEFFK 169
               |.:|         |..:::|.|             .|......:.|:.:|:.||.....||.
  Fly   403 KCYSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQQIHFWKTVQIVVEKDVVRTDRTNPFFC 467

  Fly   170 EKDGPGQEALFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMP-EEEAFAVLVQIMQQHRMRHMFK 233
            ..|.|..|.:.|::..:::::..:.|.||...::..:|.::. |.|.|...|.:||  |...:..
  Fly   468 GDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQNESETFWCFVGLMQ--RAFFVCT 530

  Fly   234 PSMSELGLCMYQLENLVQEQIPDMHIHFQQQG-FQTTMYASSWFLTLYTTTLNVNLSCRIMDVFL 297
            |:..::...:..|..|::..:|..:.|.:|.. ....::...|.|..:.......:..|:.:...
  Fly   531 PTDRDVDHNLSYLRELIRIMLPHFYKHLEQHNDSMELLFCHRWLLLCFKREFTEAVVIRMWEACW 595

  Fly   298 SEGMEFIFK--VALALLLTGKDTLLCLDM---EAMLKF 330
            |..:...|.  :.||::....|.::..::   |.:|.|
  Fly   596 SNYLTDYFHLFLCLAIIAVYADDVVAQNLRPDEMLLHF 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Evi5NP_727526.2 TBC 113..320 CDD:214540 47/242 (19%)
DUF4527 627..>731 CDD:291689
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 45/232 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.