DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Evi5 and CG1695

DIOPT Version :9

Sequence 1:NP_727526.2 Gene:Evi5 / 32088 FlyBaseID:FBgn0262740 Length:807 Species:Drosophila melanogaster
Sequence 2:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster


Alignment Length:391 Identity:87/391 - (22%)
Similarity:155/391 - (39%) Gaps:89/391 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTLTTTTTASSAE---------SQAKMDVKGGALPGE-------ENLPTSEMDLLAKLEAANKLI 49
            :::.::.:.||.|         ::||::.:  ..||:       :::.....|.....:.|..:|
  Fly   846 LSIKSSPSTSSYETVGNEFLDMAEAKLEEE--EPPGQLSKFHSADDVRLDNQDEEESSQPATAVI 908

  Fly    50 ESDAKSLNSL-----HSTHSRKNSDTSQISLTSSGNSVAEEDIWTTWATILNDWEGALKRKNPCV 109
            .::|.||::|     ....|||.|..|.::          |||     |::...:...:.|:.||
  Fly   909 ITEAASLDALDDDPTEEFTSRKTSLMSPLN----------EDI-----TVVASLDALQEPKSACV 958

  Fly   110 SELVRRGIPHHFRAIVWQQLSGASDGDKKQYAEYIKATSACEKVIRRDIARTYPEVEFFKEKDGP 174
            |.                    ||........|.::........|.:|:.|......:|..::  
  Fly   959 SP--------------------ASSNGGVYSVELLEQFGLNLHRIEKDVQRCDRNYWYFANEN-- 1001

  Fly   175 GQEALFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMPEEE-AFAVLVQIMQQHRMRHMFKPSMSE 238
             .:.|.|||..|.....:|||.||...:|..||:...:|. :::...::|:  ||...| ||...
  Fly  1002 -LDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYSCFCKLME--RMIENF-PSGGA 1062

  Fly   239 LGLCMYQLENLVQEQIPDMHIHFQQQGFQTTMY-ASSWFLTLYTTTLNVNLSCRIMDVF------ 296
            :.:....:.:|:|....:|:......|..|..| ...|||..:...|..:      |||      
  Fly  1063 MDMHFANMRSLIQILDSEMYDLMDSNGDYTHFYFCYRWFLLDFKRELVYD------DVFATWEVI 1121

  Fly   297 -----LSEGMEFIFKVALALLLTGKDTLL--CLDMEAMLKFFQKELPGRVEADVEGFFNLAYSIK 354
                 ::.| .|:..:|||||.|.:|.:|  .:|...::||| .|:..|..|  :....|:.|:.
  Fly  1122 WAAKHIASG-HFVLFLALALLETYRDIILSNSMDFTDVIKFF-NEMAERHNA--QSILQLSRSLV 1182

  Fly   355 L 355
            |
  Fly  1183 L 1183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Evi5NP_727526.2 TBC 113..320 CDD:214540 49/219 (22%)
DUF4527 627..>731 CDD:291689
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 44/208 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456624
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.