DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Evi5 and tbc

DIOPT Version :9

Sequence 1:NP_727526.2 Gene:Evi5 / 32088 FlyBaseID:FBgn0262740 Length:807 Species:Drosophila melanogaster
Sequence 2:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster


Alignment Length:438 Identity:98/438 - (22%)
Similarity:158/438 - (36%) Gaps:133/438 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TTTTTASSAESQAKMDVKGGALPGEENLPTSEMDLLAKLEAANKLIESDAK-------------- 54
            |:|.:....||..::|.     |.||       |...|.:...|:.||::|              
  Fly   756 TSTDSGHVDESFNELDE-----PDEE-------DNKQKQQQDEKISESESKLPDYRKLEEQINQE 808

  Fly    55 -----SLNSLHST------HSRKNSDTSQISLTSSGNSVAEEDIWTTWATILNDWEGALKRKNPC 108
                 |..|.:.|      |.|.||||..:   .|...::.:|:.      |.|.|.|::...| 
  Fly   809 PSCSASTASSYETVGPGEVHQRPNSDTRSV---LSPEYLSADDLQ------LPDDEDAVRPPPP- 863

  Fly   109 VSELVRRGIPHHFRAIV---------WQQLSGASDGDKKQYAE---------------YIKATSA 149
                     |.....|:         |::...|::||:....|               ..:..||
  Fly   864 ---------PAAAAVIITKASVDITNWERSPKAAEGDQMSPLEEQAGESGGAGVNMDALQQPKSA 919

  Fly   150 CEKV----------------------IRRDIARTYPEVEFFKEKDGPGQEALFNVIKAYSLHDRE 192
            |...                      |.:|:.|......:|..::   .:.|.|||..|.....:
  Fly   920 CASPASSNGGVYSSELLEQFGLNLHRIEKDVQRCDRNYWYFANEN---LDKLRNVISTYVWEHLD 981

  Fly   193 VGYCQGSGFIVGLLLMQMPEEE-AFAVLVQIMQQHRMRHMFKPSMSELGLCMYQLENLVQEQIPD 256
            |||.||...:|..||:...:|. :::...::|:  ||...| ||...:.:....:.:|:|....:
  Fly   982 VGYMQGMCDLVAPLLVIFDDESLSYSCFCKLME--RMIENF-PSGGAMDMHFANMRSLIQILDSE 1043

  Fly   257 MHIHFQQQGFQTTMY-ASSWFLTLYTTTLNVNLSCRIMDVF-----------LSEGMEFIFKVAL 309
            |:......|..|..| ...|||..:...|..:      |||           ::.| .|:..:||
  Fly  1044 MYDLMDSNGDYTHFYFCYRWFLLDFKRELVYD------DVFATWEVIWAAKHIASG-HFVLFLAL 1101

  Fly   310 ALLLTGKDTLL--CLDMEAMLKFFQKELPGRVEADVEGFFNLAYSIKL 355
            |||.|.:|.:|  .:|...::||| .|:..|..|  :....||.|:.|
  Fly  1102 ALLETYRDIILSNSMDFTDVIKFF-NEMAERHNA--QSVLQLARSLVL 1146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Evi5NP_727526.2 TBC 113..320 CDD:214540 56/265 (21%)
DUF4527 627..>731 CDD:291689
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 37/175 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.