DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Evi5 and CG4041

DIOPT Version :9

Sequence 1:NP_727526.2 Gene:Evi5 / 32088 FlyBaseID:FBgn0262740 Length:807 Species:Drosophila melanogaster
Sequence 2:NP_572197.4 Gene:CG4041 / 31422 FlyBaseID:FBgn0029736 Length:819 Species:Drosophila melanogaster


Alignment Length:392 Identity:84/392 - (21%)
Similarity:151/392 - (38%) Gaps:46/392 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 PCVSELVRR----GIPHHFRAIVWQQL-----SGASDGDKKQYAEYIKATS-ACEKVIRRDIART 161
            |..:|.::|    .:|...|..:|..|     :|:       ||:..|.|| :.::.|..||.|.
  Fly   418 PHTAEQLQREAAVDVPPLLRGPIWAALLEVVPNGS-------YAKIDKFTSTSTDRQIEVDIPRC 475

  Fly   162 YPEVEFFKEKDGPGQEALFNVIKAYSLHDREVGYCQGSGFIVG--LLLMQMPEEEAFAVLVQIMQ 224
            :...|.....|  |...|..::||:.....:..|.||...:..  |.|....||.||..|.:.:.
  Fly   476 HQYDELLSSPD--GHRKLRRLLKAWVTAHPQYVYWQGLDSLTAPFLYLNFNNEELAFLSLFKFIP 538

  Fly   225 QHRMRHMFKPSMSELGLCMYQLENLVQEQIPDMHIHFQQQGFQTTMYASSWFLTLYTTTLNVNLS 289
            ::......|.:.:.:...:.:...|.....|.:..|.....|...::|..||||:::....::..
  Fly   539 KYLQWFFLKDNSAVIKEYLSKFSQLTAFHEPLLAQHLASISFIPELFAIPWFLTMFSHVFPLHKI 603

  Fly   290 CRIMDVFLSEGMEFIFKVALALLLTGKDTLLCLDMEAMLKFFQKELPGRVEADVEGFFNLAYSIK 354
            ..:.|..:.....:...:.:|:|...:.|||.......:..| .:||..|   ::|.  :..|.|
  Fly   604 LHLWDKLMLGDSSYPLFIGIAILRQLRSTLLTSGFNECILLF-SDLPDIV---MDGC--VLESQK 662

  Fly   355 LNTKRMKKMEKEYQDLKKKEQEEM------AELRRLRRENC---LLKQRNELLEAESAELADRLV 410
            :.....|.:......|:.:..:.:      .||:.|::|.|   ..|....||:...||||...:
  Fly   663 MYEATPKSITHRQHALRLQPPQALDIGVADVELKHLQQEQCPRISAKDVQFLLDNSPAELALIDL 727

  Fly   411 RGQVSRAE-EEETSYAIQTELMQLRRSYLEVSHQLENANEEVRGLSLRLQENNVSIDSNNSRQSS 474
            |..|.... ....|..|....:||....|| :.|:.....::||        .:.:..:|..|.|
  Fly   728 RSVVEFGRVHVPHSINIPFATVQLGEQRLE-ALQVPQLEAQLRG--------KIVVCVSNIHQHS 783

  Fly   475 ID 476
            ::
  Fly   784 VE 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Evi5NP_727526.2 TBC 113..320 CDD:214540 45/218 (21%)
DUF4527 627..>731 CDD:291689
CG4041NP_572197.4 PKc_like 45..272 CDD:304357
TBC 432..634 CDD:214540 44/210 (21%)
RHOD_Kc 706..810 CDD:238783 21/89 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.