DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Evi5 and CG3703

DIOPT Version :9

Sequence 1:NP_727526.2 Gene:Evi5 / 32088 FlyBaseID:FBgn0262740 Length:807 Species:Drosophila melanogaster
Sequence 2:NP_569874.1 Gene:CG3703 / 31045 FlyBaseID:FBgn0040348 Length:711 Species:Drosophila melanogaster


Alignment Length:400 Identity:83/400 - (20%)
Similarity:149/400 - (37%) Gaps:114/400 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 ELLEAESAELAD--RLVRGQVS----RAEEEETSYAIQTELMQLRRSYLEVSHQLENANEEVRGL 454
            |:..||:.|..|  ..:.||:.    |||:||....::.|..:|                    |
  Fly     2 EMKMAEAQETKDSCSTIEGQLPAGPVRAEDEEEEVEVEQEQQEL--------------------L 46

  Fly   455 SLRLQENNVSIDSNNSRQSSIDELCMKEEALKQRDEMVSCLLEELVKVRQGLAESEDQIRNLKAK 519
            |.|......:.|..||..|.:|  |..|..|::.:            .|:|...||      .|:
  Fly    47 SERWSPLGANYDDANSASSGVD--CELEPGLEKSE------------ARRGSTGSE------LAR 91

  Fly   520 VEELEEDKKTLRETTPDNSVAHLQDELIASKLREAEASLSLKDLKQRVQELSSQWQRQLAENQRS 584
            :..:||:::.|..:            |:|.....|...|.::.:.:...|...|..|.|.:....
  Fly    92 LRSIEEEQELLTSS------------LLALTSHFAHVQLRVRQIVEAPAEERDQLLRDLEDFAFQ 144

  Fly   585 ESERTTNAVDSTPKKLLTNFFDSSKSSEHTQKLEEELMTTRIREMETLTELKELRLKVME----- 644
            .......:.:|.|.|..:   |..|......:|.::|.:       .||||:::..:..|     
  Fly   145 GIPDAVQSKESHPDKPAS---DGEKDHGPDSQLIQQLKS-------QLTELEQIAYEAGEPGILP 199

  Fly   645 ----LETQVQVSTNQLRRQDEEHKKLKEELEMAVTREKDMSNKAREQ-QHRYSDLESRMKDELMN 704
                ||.|..:       .||...||..::|     :.::...:.|| :|:   :::.:.:.:..
  Fly   200 QHVLLEKQKFI-------LDELRAKLNLQVE-----QHELPALSTEQLRHQ---VDNAIGEFVGP 249

  Fly   705 VKIKFTEQSQTVAELKQEISRLETKNSEMLA-------EGELRANLDDSDKVRDLQDRLADMKAE 762
            :|:|    .|.||:||.:|:.||    ..:|       ||.:      .|:::.|........|:
  Fly   250 LKMK----EQLVAQLKTQITDLE----RFIAFLQCDAIEGSV------GDRLKLLSGAYNSYAAK 300

  Fly   763 LTALKSRGKF 772
            .||..|:..:
  Fly   301 QTARSSQASY 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Evi5NP_727526.2 TBC 113..320 CDD:214540
DUF4527 627..>731 CDD:291689 26/113 (23%)
CG3703NP_569874.1 RUN 516..703 CDD:280855
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.