Sequence 1: | NP_001285121.1 | Gene: | Gs2 / 32087 | FlyBaseID: | FBgn0001145 | Length: | 373 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001026844.2 | Gene: | lgsn / 567024 | ZFINID: | ZDB-GENE-060312-26 | Length: | 668 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 39/202 - (19%) |
---|---|---|---|
Similarity: | 78/202 - (38%) | Gaps: | 33/202 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 IPQSPKEL---PVWN-YDGSSCYQAEGSNSDTYLYP------VAIYKDPFRRGNNILVMCDTYKF 114
Fly 115 DGTPTDTNKRKTCLEVANKCAAEEPWFGIEQEYTFLDFDGHPLGWPKNGFPGPQGPYYCGV---- 175
Fly 176 GANKVYARDIVDAHYRACLYAGIKVSGTNAEVMPAQWEFQVGPCEGISIGDDLWMARFLLHRISE 240
Fly 241 EFGIVST 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gs2 | NP_001285121.1 | PLN02284 | 27..372 | CDD:177922 | 39/202 (19%) |
lgsn | NP_001026844.2 | GlnA | 235..654 | CDD:223252 | 39/202 (19%) |
Gln-synt_N | 251..335 | CDD:281884 | 15/59 (25%) | ||
Gln-synt_C | 347..653 | CDD:278546 | 19/130 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0174 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |