DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs2 and lgsn

DIOPT Version :9

Sequence 1:NP_001285121.1 Gene:Gs2 / 32087 FlyBaseID:FBgn0001145 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001026844.2 Gene:lgsn / 567024 ZFINID:ZDB-GENE-060312-26 Length:668 Species:Danio rerio


Alignment Length:202 Identity:39/202 - (19%)
Similarity:78/202 - (38%) Gaps:33/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IPQSPKEL---PVWN-YDGSSCYQAEGSNSDTYLYP------VAIYKDPFRRGNNILVMCDTYKF 114
            :|:|..||   |..| .|.:|   |...:||..|.|      :..:.|...|     ::||....
Zfish   283 MPRSYLELTLSPQINEVDHAS---AVNFSSDVLLVPDLSTFQILPWADQTAR-----LICDPCTI 339

  Fly   115 DGTPTDTNKRKTCLEVANKCAAEEPWFGIEQEYTFLDFDGHPLGWPKNGFPGPQGPYYCGV---- 175
            .|.|..|:.|.....:..:  .:...|.:...:|   ::....|.|::  .||:..::...    
Zfish   340 TGVPLRTSPRLIAKMMLGQ--LQSMGFSLHSSFT---YECCIFGSPEH--VGPKAVFFPATTLLS 397

  Fly   176 GANKVYARDIVDAHYRACLYAGIKVSGTNAEVMPAQWEFQVGPCEGISIGDDLWMARFLLHRISE 240
            ..::.:.:.:|...|.    .|:.|...::...|.|.|....|..|:...|:.:..|..:..::.
Zfish   398 NNDQPFLQQLVKGMYN----MGVDVESFSSANGPGQMEICFKPRFGMDAADNAYTFRTGIKEMAR 458

  Fly   241 EFGIVST 247
            ::..::|
Zfish   459 KYDYIAT 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs2NP_001285121.1 PLN02284 27..372 CDD:177922 39/202 (19%)
lgsnNP_001026844.2 GlnA 235..654 CDD:223252 39/202 (19%)
Gln-synt_N 251..335 CDD:281884 15/59 (25%)
Gln-synt_C 347..653 CDD:278546 19/130 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0174
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.