DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs2 and LGSN

DIOPT Version :9

Sequence 1:NP_001285121.1 Gene:Gs2 / 32087 FlyBaseID:FBgn0001145 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_011534191.1 Gene:LGSN / 51557 HGNCID:21016 Length:590 Species:Homo sapiens


Alignment Length:224 Identity:45/224 - (20%)
Similarity:76/224 - (33%) Gaps:79/224 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LDFIPQSPKELPVWNYDGSSCYQAEGSNSDTYLYP------VAIYKDPFRRGNNILVMCDTYKFD 115
            |:.|| :||:..: |...::|:     |||..|.|      |..:.|...|     |:|||:...
Human   205 LEVIP-NPKDNEM-NNIRATCF-----NSDIVLMPELSTFRVLPWADRTAR-----VICDTFTVT 257

  Fly   116 GTPTDTNKR-----------------------KTCL----EVANKCAAEEPWFGIEQEYTFLDFD 153
            |.|..|:.|                       ..|:    |:.|......|      ..|||:..
Human   258 GEPLLTSPRYIAKRQLSHLQASGFSLLSAFIYDFCIFGVPEILNSKIISFP------ALTFLNNH 316

  Fly   154 GHPLGWPKNGFPGPQGPYYCGVGANKVYARDIVDAHYRACLYAGIKVSGTNAEVMPAQWEFQVGP 218
            ..|                        :.:::||..|    :.|..|...::...|.|.|....|
Human   317 DQP------------------------FMQELVDGLY----HTGANVESFSSSTRPGQMEISFLP 353

  Fly   219 CEGISIGDDLWMARFLLHRISEEFGIVST 247
            ..|||..|:.:..|..:..::.::..:::
Human   354 EFGISSADNAFTLRTGVKEVARKYNYIAS 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs2NP_001285121.1 PLN02284 27..372 CDD:177922 45/224 (20%)
LGSNXP_011534191.1 GlnA 162..574 CDD:223252 45/224 (20%)
Gln-synt_N 167..252 CDD:281884 16/58 (28%)
Gln-synt_C 264..588 CDD:278546 23/153 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0174
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.