DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs2 and Lgsn

DIOPT Version :9

Sequence 1:NP_001285121.1 Gene:Gs2 / 32087 FlyBaseID:FBgn0001145 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_017451925.1 Gene:Lgsn / 316304 RGDID:727925 Length:565 Species:Rattus norvegicus


Alignment Length:385 Identity:72/385 - (18%)
Similarity:142/385 - (36%) Gaps:103/385 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LDRYLSLP---LQENIVQATYVWIDGTGEDLRCKDRTLDFIPQSPKELPVWNYDGSSCYQAEGSN 84
            :.|..|:|   .||.::...::           ....|:.:| :||:..| |:..::|:     |
  Rat   154 VSRSKSIPAQFFQEKVIHGVFM-----------PRGYLELMP-NPKDNEV-NHIRATCF-----N 200

  Fly    85 SDTYLYPVAIYKDPFR----RGNNILVMCDTYKFDGTPTDTNKRKTCLEVANKCAAEEPWFGIEQ 145
            ||..|.|..   ..||    ......|:|||:...|.|..|:.|........:  .::..|.:..
  Rat   201 SDIVLMPEL---STFRVLPWAERTARVICDTFTVTGEPLLTSPRYIAKRQLRQ--LQDAGFSLLS 260

  Fly   146 EYTFLDF---------DGHPLGWPKNGFPGPQGPYYCGVGANKVYARDIVDAHYRACLYAGIKVS 201
            .:.: ||         :...:.:|.:....         ..::.:.:::||..|    :.|..|.
  Rat   261 AFIY-DFCIFGVPEVINSKTISFPASTLLS---------NHDQPFMQELVDGLY----HTGANVE 311

  Fly   202 GTNAEVMPAQWEFQVGPCEGISIGDDLWMARFLLHRISEEFGIVSTLDPKPMPGDWN-GAGAHT- 264
            ..::...|.|.|....|..|||..|:.:..|..:..::..:..:::|..:  .|..| |..:|: 
  Rat   312 SFSSSTRPGQMEICFLPEFGISSADNAFTLRTGVQEVARRYNYIASLVIE--TGFCNSGILSHSI 374

  Fly   265 -NVS--TKAMREDGGIRDI----EKAVAKLSK--------------CHERHIRAYDPKQGQDNAR 308
             :||  |.......|:..:    :|.:|.|.|              |.:|:.:  |.:..:|:..
  Rat   375 WDVSGKTNMFYSGSGVERLTLTGKKWLAGLLKHSAALSCLMAPAVNCRKRYCK--DSRDLKDSVP 437

  Fly   309 RLTGKHETSSINDFSAGVANRGCSIRI----PRGVNDDGKGYFEDRRPSSNCDPYSVVEA 364
            ...|.::.|             |::.:    .:|..      .|::..|:..:||.|:.|
  Rat   438 TTWGYNDNS-------------CALNVKCHGEKGTQ------IENKLGSATANPYLVLAA 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs2NP_001285121.1 PLN02284 27..372 CDD:177922 71/381 (19%)
LgsnXP_017451925.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0174
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.