DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs2 and Lgsn

DIOPT Version :9

Sequence 1:NP_001285121.1 Gene:Gs2 / 32087 FlyBaseID:FBgn0001145 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_705829.1 Gene:Lgsn / 266744 MGIID:2672844 Length:563 Species:Mus musculus


Alignment Length:391 Identity:73/391 - (18%)
Similarity:138/391 - (35%) Gaps:115/391 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LDRYLSLP---LQENIVQATYVWIDGTGEDLRCKDRTLDFIPQSPKELPVWNYDGSSCYQAEGSN 84
            :.|..|:|   .||.::...::           ....|:.:| :||:..| |:..::|:     |
Mouse   152 VSRSKSIPAQFFQEKVIHGVFM-----------PRGYLELMP-NPKDNEV-NHIRATCF-----N 198

  Fly    85 SDTYLYPVAIYKDPFR----RGNNILVMCDTYKFDGTPTDTNKRKTC------LEVANKCAA--- 136
            ||..|.|..   ..||    ......|:|||:...|.|..|:.|...      |:.|..|..   
Mouse   199 SDIVLMPEL---STFRVLPWAERTARVICDTFTVTGEPLLTSPRYIAKRQLRQLQDAGFCLLSAF 260

  Fly   137 --EEPWFGIEQEYTFLDFDGHPLGWPKNGFPGPQGPYYCGVGANKVYARDIVDAHYRACLYAGIK 199
              :...||:.:.     .:...:.:|.:....         ..::.:.:::|:..|:    .|..
Mouse   261 IYDFCIFGVPEV-----INSKTISFPASTLLS---------NHDQPFMQELVEGLYQ----TGAN 307

  Fly   200 VSGTNAEVMPAQWEFQVGPCEGISIGDDLWMARFLLHRISEEFGIVSTLDPKPMPGDWNG----- 259
            |...::...|.|.|....|..|||..|:.:..|..|..::..:..:::|..:  .|..|.     
Mouse   308 VESFSSSTRPGQMEICFLPEFGISSADNAFTLRTGLQEVARRYNYIASLVIE--TGFCNSGILSH 370

  Fly   260 ----AGAHTNVSTKAMREDGGIRDI----EKAVAKLSK--------------CHERHIRAYDPKQ 302
                .|..||:....    .|:..:    :|.:|.|.|              |.:|:.:  |.:.
Mouse   371 SIWDVGGKTNMFCSG----SGVERLTLTGKKWLAGLLKHSAALSCLMAPAVNCRKRYCK--DSRD 429

  Fly   303 GQDNARRLTGKHETSSINDFSAGVANRGCSIRI----PRGVNDDGKGYFEDRRPSSNCDPYSVVE 363
            .:|:.....|.::.|             |::.|    .:|..      .|::..|:..:||.|:.
Mouse   430 LKDSVPTTWGYNDNS-------------CALNIKCHGEKGTQ------IENKLGSATANPYLVLA 475

  Fly   364 A 364
            |
Mouse   476 A 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs2NP_001285121.1 PLN02284 27..372 CDD:177922 72/387 (19%)
LgsnNP_705829.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
GlnA 130..547 CDD:223252 73/391 (19%)
Gln-synt_N 140..225 CDD:281884 20/93 (22%)
Gln-synt_C 237..561 CDD:278546 47/285 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0174
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.