DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or19a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:419 Identity:83/419 - (19%)
Similarity:149/419 - (35%) Gaps:97/419 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IMG-YWPGK--------TGDTWPWRSLIHFAILAIGVATELHAGMCFLDRQQITLALETLCPAGT 83
            ||| :.|||        |..:..|....|   :.|.|:..::    .|....:....|:||....
  Fly    21 IMGIHPPGKRTFWGRHYTAYSMVWNVTFH---ICIWVSFSVN----LLQSNSLETFCESLCVTMP 78

  Fly    84 SAVTLLKMFLMLRFR-QDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPLSAGFFT 147
            ..:.:||:..:.|.| |.:|..| .||  |.|......::|.| :......|...|..:..| ..
  Fly    79 HTLYMLKLINVRRMRGQMISSHW-LLR--LLDKRLGCDDERQI-IMAGIERAEFIFRTIFRG-LA 138

  Fly   148 CTTYNLKPILIAMILYLQNRYEDFVWF---TPFN-------------------MTMPKVLLNYPF 190
            ||       ::..|:|:....|..:.:   .|:|                   |....::||...
  Fly   139 CT-------VVLGIIYISASSEPTLMYPTWIPWNWRDSTSAYLATAMLHTTALMANATLVLNLSS 196

  Fly   191 FPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELS------P 249
            :|.||:.:.                    ..|..||                 .|.:|      |
  Fly   197 YPGTYLILV--------------------SVHTKAL-----------------ALRVSKLGYGAP 224

  Fly   250 VQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAML 314
            :....::..:...|..|..|:.|.:......::.....|.|.|.. ..::...|..||.|:...:
  Fly   225 LPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACA-QCTICYFLLFGNVGIMRFM 288

  Fly   315 YVAYTVAAL-SQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAV 378
            .:.:.:..| ::.|:.||...|..:....|..|::||.|.......|||:.|::.|.|.|:.:..
  Fly   289 NMLFLLVILTTETLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVS 353

  Fly   379 PFFSP-SLATFAAILQTSGSIIALVKSFQ 406
            ....| |:.||..:::.:.:::.|:...:
  Fly   354 GVIVPISMKTFTVMIKGAYTMLTLLNEIR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 70/356 (20%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 70/356 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.