DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or98b

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:401 Identity:84/401 - (20%)
Similarity:157/401 - (39%) Gaps:80/401 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GDTWPWRSLIHFAILAIGVATELHAGMCFLDRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDL 101
            |..:||||:.  .||::.....|.......:.|.:....::||......:.|.|:.|.|...:|.
  Fly    28 GHRYPWRSIC--CILSVASFMPLTIAFGLQNVQNVEQLTDSLCSVLVDLLALCKIGLFLWLYKDF 90

  Fly   102 SIMWNRLRGLLFDPNW--------ERPEQRDIRLKHSAMAARINFWPLSAGFFTCTTYNLKPILI 158
            ..:..:...:|.....        .|..:||..:  |||.|   :..::||...|.   :.|  :
  Fly    91 KFLIGQFYCVLQTETHTAVAEMIVTRESRRDQFI--SAMYA---YCFITAGLSACL---MSP--L 145

  Fly   159 AMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPLTYIF--IAYTGYVTIFMFGGC--------- 212
            :|::..|...|          ..||    :| ||..|.:  :..:.|:..:.:..|         
  Fly   146 SMLISYQRTGE----------LQPK----FP-FPSVYPWDNMKLSNYIISYFWNVCAALGVALPT 195

  Fly   213 ---DGFYFEFCAHLSALFEVLQAEIESMFRPYT--DHLELSPV-QLYILEQKMRSVIIRHNAIID 271
               |..:.....:|.|||::.:.::.......|  .|..|..| |||.|             .::
  Fly   196 VCVDTLFCSLSHNLCALFQIARHKMMHFEGRNTKETHENLKHVFQLYAL-------------CLN 247

  Fly   272 LTRFFRDRYTIITLAHFVSAAM---VIGFSM-VNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYG 332
            |..|..:.:..: :..||:|::   |:.:.: .|:|.     ...:.|.|:|.|.:.|:.:||:.
  Fly   248 LGHFLNEYFRPL-ICQFVAASLHLCVLCYQLSANILQ-----PALLFYAAFTAAVVGQVSIYCFC 306

  Fly   333 GTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVP----FFSPSLATFAAILQ 393
            |:.:........:|::...|.....:..:||..|.:...|. |:..|    ||..:..|...|::
  Fly   307 GSSIHSECQLFGQAIYESSWPHLLQENLQLVSSLKIAMMRS-SLGCPIDGYFFEANRETLITIVR 370

  Fly   394 TSGSIIALVKS 404
            |:.|.:.|::|
  Fly   371 TAISYVTLLRS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 72/358 (20%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 71/357 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.