DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or98a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:365 Identity:77/365 - (21%)
Similarity:125/365 - (34%) Gaps:84/365 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 TLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPL 141
            |.|.........|.:.:::.|:.|::         .|.|| |......:......|..::.|:.|
  Fly    46 TSCLIFAWCAVYLPIGIIISFKTDIN---------TFTPN-ELLTVMQLFFNSVGMPFKVLFFNL 100

  Fly   142 -SAGFFTCTTYNLKPILIAM---ILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPLTYIFIAYTG 202
             .:||     |..|.:|..|   ...|:.|.|........|    |..|.|.|     |:.||| 
  Fly   101 YISGF-----YKAKKLLSEMDKRCTTLKERVEVHQGVVRCN----KAYLIYQF-----IYTAYT- 150

  Fly   203 YVTIFMFGGCDGF--------YFEFCAHLSALFEVLQAEIESMFRPYTD---------------- 243
             ::.|:.....|.        :.:|....|:.::....|...|....|.                
  Fly   151 -ISTFLSAALSGKLPWRIYNPFVDFRESRSSFWKAALNETALMLFAVTQTLMSDIYPLLYGLILR 214

  Fly   244 -HLELSPVQLYIL-----------EQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIG 296
             ||:|..:::..|           ||.:...|..||.|||.....|...|......|:...:.:|
  Fly   215 VHLKLLRLRVESLCTDSGKSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLLIGICLG 279

  Fly   297 FSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRR 361
            .||:|||...:...| :..|||....:.|...:|:...|:.:....|..|:|...|         
  Fly   280 LSMINLLFFADIWTG-LATVAYINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNW--------- 334

  Fly   362 LVQLLILRSQRPVSMAVPFFSPSLATFAAILQTSGSIIAL 401
                  :.|.|....::.:|..:..  .:|..|:|||..:
  Fly   335 ------INSSRSYKSSLRYFLKNAQ--KSIAFTAGSIFPI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 74/358 (21%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 71/328 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465127
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.