DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or94b

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster


Alignment Length:330 Identity:72/330 - (21%)
Similarity:127/330 - (38%) Gaps:67/330 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LSIMWNR------LRGLLFDPNWERPEQRDIRL--KHSAMAARINFWPLSAGFFTCTTYNLKPIL 157
            |:|.:.|      :..|..||.:......:|:.  ::.....||.:|.:....|..       ::
  Fly    88 LNIWYRRHEAASLIHELQHDPAFNLRNSEEIKFWQQNQRNFKRIFYWYIWGSLFVA-------VM 145

  Fly   158 IAMILYLQNRYE-DFVWFTPFNMTMPKVLLNYPFFPLTYIFIAYTGYVTIFMFGGC------D-- 213
            ..:.::.|..|| .|.::.||..   :....|        |.|: ||..:.|...|      |  
  Fly   146 GYISVFFQEDYELPFGYYVPFEW---RTRERY--------FYAW-GYNVVAMTLCCLSNILLDTL 198

  Fly   214 GFYFEFCAHLSALFEVLQAEIESM-------FRPYTDHLELSPVQLYILEQKMRSVIIRHNAIID 271
            |.||.|  |:::||.:|...:|::       .||                 ::|.:...|..:..
  Fly   199 GCYFMF--HIASLFRLLGMRLEALKNAAEEKARP-----------------ELRRIFQLHTKVRR 244

  Fly   272 LTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLG---NNGLGAMLYVAYTVAALSQLLVYCYGG 333
            |||......:...|:..|.:|.:|.||...|:.:|   ..|| .:..|.:....:.|:.:.||.|
  Fly   245 LTRECEVLVSPYVLSQVVFSAFIICFSAYRLVHMGFKQRPGL-FVTTVQFVAVMIVQIFLPCYYG 308

  Fly   334 TLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-AVPFFSPSLATFAAILQTSGS 397
            ..:...:..|..::|...|..:....|:|:...:...:|||.: |..||...|..|...:..:.|
  Fly   309 NELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYS 373

  Fly   398 IIALV 402
            ..||:
  Fly   374 FFALL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 69/322 (21%)
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 69/322 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465440
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.