DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or94a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:414 Identity:89/414 - (21%)
Similarity:164/414 - (39%) Gaps:77/414 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RLSLDIM---GYWPG--KTGDTWP--------WRSLIHFAILAIGVATELHAGMCFLD---RQQI 71
            ||.|.:|   |.||.  |:.:.|.        :|.|:|..|      |....|:.:|:   ...:
  Fly    12 RLILQVMQLFGLWPWSLKSEEEWTFTGFVKRNYRFLLHLPI------TFTFIGLMWLEAFISSNL 70

  Fly    72 TLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARI 136
            ..|.:.|..:.|....::|:..:..:|.:   .|..:..|...|:::...|.:           :
  Fly    71 EQAGQVLYMSITEMALVVKILSIWHYRTE---AWRLMYELQHAPDYQLHNQEE-----------V 121

  Fly   137 NFWPLSAGFFTCTTYNLKPILIAM---------ILYLQNRYEDFVWFTPFNMTMPK---VLLNYP 189
            :||.....||....|..  |||::         :|:|:.....|.::.||.....:   ....|.
  Fly   122 DFWRREQRFFKWFFYIY--ILISLGVVYSGCTGVLFLEGYELPFAYYVPFEWQNERRYWFAYGYD 184

  Fly   190 FFPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYI 254
            ...:|...|:.....|:    ||   ||.|  |:|.|:.:|...:........|         .|
  Fly   185 MAGMTLTCISNITLDTL----GC---YFLF--HISLLYRLLGLRLRETKNMKND---------TI 231

  Fly   255 LEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLG---NNG--LGAML 314
            ..|::|::.|.|..|..||...:...:...|:..:.:|::|.||...|..:|   |.|  :..:.
  Fly   232 FGQQLRAIFIMHQRIRSLTLTCQRIVSPYILSQIILSALIICFSGYRLQHVGIRDNPGQFISMLQ 296

  Fly   315 YVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-AV 378
            :|:..:.   |:.:.||.|..:...:..|...::...|...:|..|:|:...:...::||:: |.
  Fly   297 FVSVMIL---QIYLPCYYGNEITVYANQLTNEVYHTNWLECRPPIRKLLNAYMEHLKKPVTIRAG 358

  Fly   379 PFFSPSLATFAAILQTSGSIIALV 402
            .||:..|..|...:..:.|.:||:
  Fly   359 NFFAVGLPIFVKTINNAYSFLALL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 70/343 (20%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 70/343 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465439
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.