DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or88a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:418 Identity:81/418 - (19%)
Similarity:148/418 - (35%) Gaps:99/418 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LDVYFFAVPRLSLDIMG-YWPGKTGDTWPWRSLIHFAILAIGVATELHAGMCFLDRQQITLALET 77
            |:|.||...  ..||:| :|.|...:..|       .:|:|.:...:...|.:|.|::|...:..
  Fly    55 LNVLFFGCN--GWDIIGHFWLGHPANQNP-------PVLSITIYFSIRGLMLYLKRKEIVEFVND 110

  Fly    78 L---CPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFW 139
            |   ||  ...|:.|.|.:...:|.    .|.|.|                         .|..:
  Fly   111 LDRECP--RDLVSQLDMQMDETYRN----FWQRYR-------------------------FIRIY 144

  Fly   140 PLSAGFFTCTTYNLKPILIAMILYLQN---------RYEDFV--WFTPFNMTMPKVLLNYPFFPL 193
            ....|...|        ::.:.|:|..         ::|..:  |       :|..:...|.|  
  Fly   145 SHLGGPMFC--------VVPLALFLLTHEGKDTPVAQHEQLLGGW-------LPCGVRKDPNF-- 192

  Fly   194 TYIFIAYTGYVTIFMFG-GCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHL-----ELSPVQL 252
                     |:.::.|. .|......|......||.|:|..:..    :..||     .:.|.|.
  Fly   193 ---------YLLVWSFDLMCTTCGVSFFVTFDNLFNVMQGHLVM----HLGHLARQFSAIDPRQS 244

  Fly   253 YILEQK----MRSVIIRHNAIIDLTRFFRDRYTIITL-AHFVSAAMVIGFSMVNLLTLGNNGLGA 312
            ...|::    :|.::.|...:..|.|.:.|.:.:..| ::||.|..:..:  :.:|:..::.|..
  Fly   245 LTDEKRFFVDLRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFVGAGSLCFY--LFMLSETSDVLII 307

  Fly   313 MLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM- 376
            ..|:..|:..:......|..||.:.::|.||..::.|..|.|...:.|:...|.....||...: 
  Fly   308 AQYILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLG 372

  Fly   377 AVPFFSPSLATFAAILQTSGSIIALVKS 404
            |......::..|..|:|.:..:...:||
  Fly   373 AFGLIQVNMVHFTEIMQLAYRLFTFLKS 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 64/351 (18%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 70/386 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.