DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or85d

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:436 Identity:91/436 - (20%)
Similarity:179/436 - (41%) Gaps:89/436 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLKRDQQLDVYFFAVPRLSLDIMGYWPGKTGDTWPWRSLIHFAILA-------------IGVATE 58
            |||   ..:|::     ||:.:|.| ..|....|. ..|:|:..:|             |.|...
  Fly    24 FLK---YANVFY-----LSIGMMAY-DHKYSQKWK-EVLLHWTFIAQMVNLNTVLISELIYVFLA 78

  Fly    59 LHAGMCFLDRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRL-----RGLLFDPNWE 118
            :..|..||:      |...|...|...|...|::.:.|.|:.|:.:.:||     :||       
  Fly    79 IGKGSNFLE------ATMNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQGL------- 130

  Fly   119 RPEQRDIRLKHSAMA-ARINFWPLSAGFFTCTTYNLKPILIAMILYLQNRYEDFVWFTPFNMTMP 182
             .:|....:.|.... :|.:.:..........||||...:..::.       || |   ..|...
  Fly   131 -AQQEPYNIGHHLSGYSRYSKFYFGMHMVLIWTYNLYWAVYYLVC-------DF-W---LGMRQF 183

  Fly   183 KVLLNYPFFPLTYIFIAY---TGYVTIFMF-----GGCDGFYFEFCAHLSALFEVLQAEIESM-- 237
            :.:|.|      |.::.:   |||...||:     ||      :.|.......::|...:.::  
  Fly   184 ERMLPY------YCWVPWDWSTGYSYYFMYISQNIGG------QACLSGQLAADMLMCALVTLVV 236

  Fly   238 --FRPYTDHLELSPVQLYILE---QKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVI-- 295
              |...:.|:|.....:...:   :.:::.:..|.::|.|.:...:.:.:..|::|||::.:|  
  Fly   237 MHFIRLSAHIESHVAGIGSFQHDLEFLQATVAYHQSLIHLCQDINEIFGVSLLSNFVSSSFIICF 301

  Fly   296 -GFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQ 359
             ||.|    |:|:.....::.|.:...|:.|:.:.......:.::|..:.:|:::..|.....:.
  Fly   302 VGFQM----TIGSKIDNLVMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNHDWFRADLRY 362

  Fly   360 RRLVQLLILRSQRPVSM-AVPFFSPSLATFAAILQTSGSIIALVKS 404
            |:::.|:|.|:|:|..: |..|.:.||.|.:.:||.|....||:::
  Fly   363 RKMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFALLRT 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 70/350 (20%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 72/356 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.