DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or85b

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:396 Identity:91/396 - (22%)
Similarity:171/396 - (43%) Gaps:80/396 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 WRSLIHFAILAIGVATELHAGMCFLDRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWN 106
            |.::|:.:.  :|:...::....|:|.:.:. |:..|...|...|.:.|||.:...:..::.:.|
  Fly    38 WSNVINLSF--VGLFESIYVYSAFMDNKFLE-AVTALSYIGFVTVGMSKMFFIRWKKTAITELIN 99

  Fly   107 RLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPLSAGFFTCTTYNL-KPILIAMILYLQNRY-- 168
            .|:.:.  ||....|:            |.|. |:..|  ||:..:| ..:|.:::::..|.:  
  Fly   100 ELKEIY--PNGLIREE------------RYNL-PMYLG--TCSRISLIYSLLYSVLIWTFNLFCV 147

  Fly   169 -EDFV---WFT--------PFNMTMP-KVLLNYPFFPLTYI--FIAYT---GYVTIFMFGGCDGF 215
             |.:|   |..        |:.|.:| |...|:.::||.:.  |..||   |.::..:.      
  Fly   148 MEYWVYDKWLNIRVVGKQLPYLMYIPWKWQDNWSYYPLLFSQNFAGYTSAAGQISTDVL------ 206

  Fly   216 YFEFCAHLSAL---FEVLQAEIESMFRPYTDHLELSPVQLYILEQKMRS-----VIIRHNAIIDL 272
               .||..:.|   |:.|...:|.       | |||.      :.|..|     ::..|..|:.|
  Fly   207 ---LCAVATQLVMHFDFLSNSMER-------H-ELSG------DWKKDSRFLVDIVRYHERILRL 254

  Fly   273 TRFFRDRYTIITLAHFVSAAMVI---GFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGT 334
            :....|.:.|..|.:|:.::.||   ||.|    |:|......:....:.|:::||:.:.|:.|.
  Fly   255 SDAVNDIFGIPLLLNFMVSSFVICFVGFQM----TVGVPPDIVVKLFLFLVSSMSQVYLICHYGQ 315

  Fly   335 LVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-AVPFFSPSLATFAAILQTSGSI 398
            |||::|.|...|.::..|.....:.:|.:.::|.|||:...: |..|...:.:|...:||.|...
  Fly   316 LVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKF 380

  Fly   399 IALVKS 404
            .||:::
  Fly   381 FALLRT 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 83/358 (23%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 83/358 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.