DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or83c

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:263 Identity:56/263 - (21%)
Similarity:107/263 - (40%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 IAMILYLQNRYEDFVWFTPFNMTMPKVLL--NYPFFPLTYIFIAYTGYVTIFMFGGCDGFYFEFC 220
            :||::|      |....|.....:|.:.|  || .:.:||:....|..|....|...|.|.|...
  Fly   150 LAMLMY------DGTRVTAMQYLIPGLPLENNY-CYVVTYMIQTVTMLVQGVGFYSGDLFVFLGL 207

  Fly   221 AHLSALFEVLQAEIESMFRPYTDHLELSPVQLYIL---------EQKMR---SVIIRHNAIIDLT 273
            ..:....::||.:::.:    .|.||.......::         |.:.|   .||..|....|..
  Fly   208 TQILTFADMLQVKVKEL----NDALEQKAEYRALVRVGASIDGAENRQRLLLDVIRWHQLFTDYC 268

  Fly   274 RFFRDRY--TIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLV 336
            |.....|  .|.|....::.||::.|    .:.|.:..:.:.::  :.|:|.| :.:||..||::
  Fly   269 RAINALYYELIATQVLSMALAMMLSF----CINLSSFHMPSAIF--FVVSAYS-MSIYCILGTIL 326

  Fly   337 AESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVPFFSPSLATFAAILQTSGSIIAL 401
            ..:...:..::.:..|.....:||:|...|:..||.|.::.:      |...:..::|:..|:.|
  Fly   327 EFAYDQVYESICNVTWYELSGEQRKLFGFLLRESQYPHNIQI------LGVMSLSVRTALQIVKL 385

  Fly   402 VKS 404
            :.|
  Fly   386 IYS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 53/253 (21%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 55/260 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465028
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.