DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or83a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:402 Identity:70/402 - (17%)
Similarity:135/402 - (33%) Gaps:111/402 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAAR 135
            :...::|:....|.|   :|::.. |||..|      |..:|.:.|.|...:..:......||. 
  Fly    88 VNCLIQTIIYLWTIA---MKLYFR-RFRPGL------LNTILSNINDEYETRSAVGFSFVTMAG- 141

  Fly   136 INFWPLSAGFFTCTTYNLKPILIAMILY-----------LQNRYED-----FVWFTPFNMTMPKV 184
                          :|.:..:.|...:|           |...|.|     ..|: ||:.|.|.|
  Fly   142 --------------SYRMSKLWIKTYVYCCYIGTIFWLALPIAYRDRSLPLACWY-PFDYTQPGV 191

  Fly   185 LLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPY-----TDH 244
                  :.:.::..|.........|....|.:...|..:|..::||...::::....     .:.
  Fly   192 ------YEVVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQYDVLFCSLKNVLASSYVLMGANM 250

  Fly   245 LELSPVQ-------------LYILEQKM-RSVIIRHNAIIDLTRFFR---------DRYTI---- 282
            .||:.:|             .|.:|::. ...:::..:.:|.:..||         .||.:    
  Fly   251 TELNQLQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFSSAFRLSFVRCIQHHRYIVAALK 315

  Fly   283 --------------------ITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLL 327
                                :.|..|||.......|.:.:::||.          |.:..|.:|.
  Fly   316 KIESFYSPIWFVKIGEVTFLMCLVAFVSTKSTAANSFMRMVSLGQ----------YLLLVLYELF 370

  Fly   328 VYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVPFFSP-SLATFAAI 391
            :.||...:|.::|.....|::..|||......|......:|.|:|...:.....|. ::..|...
  Fly   371 IICYFADIVFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQLTAGKISNLNVDRFRGT 435

  Fly   392 LQTSGSIIALVK 403
            :.|:.|.:.|::
  Fly   436 ITTAFSFLTLLQ 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 68/393 (17%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 52/301 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.