DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or71a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster


Alignment Length:410 Identity:90/410 - (21%)
Similarity:154/410 - (37%) Gaps:101/410 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WLRFLK-RDQQ--LDVYFFAVPRLSLDIMGYWPGKTGDTWPWRSLIHFAILAIGVATELHAGMCF 65
            ||..:| ||.|  .||....:...:|.      ||..:.|      .:|.:|.|:.:|......|
  Fly    54 WLEAIKSRDIQHTADVLLICLTTTALG------GKVINIW------KYAHVAQGILSEWSTWDLF 106

  Fly    66 LDRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHS 130
                                        .||.:|::. ||                    |.:|.
  Fly   107 ----------------------------ELRSKQEVD-MW--------------------RFEHR 122

  Fly   131 AMAARINFWPL-SAGFFTCTTYNLKPILIAMILY-LQNRYEDFVWFTPFNMTMPKVLLNYPF-FP 192
            .......|:.| |||..        |.::...|: :.||...::| |||:...| ||..|.| :.
  Fly   123 RFNRVFMFYCLCSAGVI--------PFIVIQPLFDIPNRLPFWMW-TPFDWQQP-VLFWYAFIYQ 177

  Fly   193 LTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYILEQ 257
            .|.|.||....||:      |...:....|||....:|...:..:.....| |....::|..|.|
  Fly   178 ATTIPIACACNVTM------DAVNWYLMLHLSLCLRMLGQRLSKLQHDDKD-LREKFLELIHLHQ 235

  Fly   258 KMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNL----LTLGNNGLGAMLYVAY 318
            :::...:.....|..:          |....:.::::|.|::.::    :.....|..||:  .|
  Fly   236 RLKQQALSIEIFISKS----------TFTQILVSSLIICFTIYSMQMSPVLQDLPGFAAMM--QY 288

  Fly   319 TVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-AVPFFS 382
            .||.:.|:::....|..|.:|:..|..:|::..|.....:.||||.:.::...|||:: |..||.
  Fly   289 LVAMIMQVMLPTIYGNAVIDSANMLTDSMYNSDWPDMNCRMRRLVLMFMVYLNRPVTLKAGGFFH 353

  Fly   383 PSLATFAAILQTSGSIIALV 402
            ..|..|...:..:.|::||:
  Fly   354 IGLPLFTKTMNQAYSLLALL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 70/333 (21%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 81/388 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.