DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or67d

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster


Alignment Length:415 Identity:82/415 - (19%)
Similarity:146/415 - (35%) Gaps:159/415 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KMFLMLRF-----RQDLSIMWNRLRGLLFDPN----WERPEQRDIRLKHSAMAARINFWPLSAGF 145
            |:..|:||     ..|::           |||    |         |.::.|||       .|.|
  Fly    15 KVIRMIRFCVGFCGNDVA-----------DPNFRMWW---------LTYAVMAA-------IAFF 52

  Fly   146 FTCTTY----------NLKPILIAMILY----------------------LQNRYED-------- 170
            |.||.|          :|..||.|:.:.                      :||.|||        
  Fly    53 FACTGYTIYVGVVINGDLTIILQALAMVGSAVQGLTKLLVTANNASHMREVQNTYEDIYREYGSK 117

  Fly   171 -------------FVW-----FTPFNMTMPKVLLNYPFFPLTYI------------FIAYT---- 201
                         ..|     |....:.:..:::.:|.|.|..:            |:.:|    
  Fly   118 GDEYAKCLEKRIRITWTLLIGFMLVYIILLGLVITFPIFYLLILHQKVLVMQFLIPFLDHTTDGG 182

  Fly   202 ------GYVTIFMFGGC-----DGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYIL 255
                  .:|.:..|||.     |.:.|.|..|:..:.::...::       |:..||      ::
  Fly   183 HLILTAAHVILITFGGFGNYGGDMYLFLFVTHVPLIKDIFCVKL-------TEFNEL------VM 234

  Fly   256 EQ----KMRS----VIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLL-TLG----N 307
            ::    |:|:    :::.|..   .||..:....|.::..||.    :..:.|.|| |:.    .
  Fly   235 KRNDFPKVRAMLCDLLVWHQL---YTRMLQTTKKIYSIVLFVQ----LSTTCVGLLCTISCIFMK 292

  Fly   308 NGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMF-SCPWQLFKPKQRRLVQLLILRSQ 371
            ....|.||:.|  ||:: |..:|..||||..|:......:: :|.|.....|:.:|:.:::.::|
  Fly   293 AWPAAPLYLLY--AAIT-LYTFCGLGTLVENSNEDFLSVIYTNCLWYELPVKEEKLIIMMLAKAQ 354

  Fly   372 RPVSMAVPFFSPSLATFAAILQTSG 396
            ..|.:.....:| |:...|:..|.|
  Fly   355 NEVVLTAADMAP-LSMNTALQLTKG 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 81/413 (20%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 63/334 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465027
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.