DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or67c

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster


Alignment Length:407 Identity:99/407 - (24%)
Similarity:167/407 - (41%) Gaps:84/407 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TWPWRSL----------IHFAILAIGVATELHAGMCFLDRQQITLALETLCPAGTSAVTLLKMFL 93
            |.|.:||          |:|.:|.||.....:..:  .|.:.|.||:......|.|.|...|...
  Fly    36 TNPLKSLLFKIYLYAGFINFNLLVIGELVFFYNSI--QDFETIRLAIAVAPCIGFSLVADFKQAA 98

  Fly    94 MLRFRQDLSIMWNRLRGLLFDPNWERP----EQRDIRLK--HSAMAARINFWPLSAGFFTC---- 148
            |:|.::.|.::.:.|..:       .|    :|.:.:|.  ...|...||.:.     |.|    
  Fly    99 MIRGKKTLIMLLDDLENM-------HPKTLAKQMEYKLPDFEKTMKRVINIFT-----FLCLAYT 151

  Fly   149 TTYNLKPILIAMILYLQNRYEDF-------VWFTPFNMTMPKVLLNYPFFPLTYIFIAYTGYVTI 206
            ||::..|.:.|.:.:....|:.|       :|| ||:.|.     |...:.:.|..||:..|:..
  Fly   152 TTFSFYPAIKASVKFNFLGYDTFDRNFGFLIWF-PFDATR-----NNLIYWIMYWDIAHGAYLAG 210

  Fly   207 FMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYILEQK-----MRSVIIRH 266
            ..|         .||.|  |..|:..:|...|...:..||..|....  |.|     :..:|..|
  Fly   211 IAF---------LCADL--LLVVVITQICMHFNYISMRLEDHPCNSN--EDKENIEFLIGIIRYH 262

  Fly   267 NAIIDLTRFFRDRYTIITLAHFVSAAMVIGF-------SMVNLLTLGNNGLGAMLYVAYTVAALS 324
            :..:.|.....|.|:...|.:|:.|:|.|.|       |.|.::         ::|..:.:.::.
  Fly   263 DKCLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVEVI---------IIYCIFLMTSMV 318

  Fly   325 QLLVYC-YGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVPFFSP-SLAT 387
            |:.:.| ||.||:| :|..:..|.::..|.........:::|||:|||:|.|:..|.|.| ||.|
  Fly   319 QVFMVCYYGDTLIA-ASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVT 382

  Fly   388 FAAILQTSGSIIALVKS 404
            :..::..|....||:::
  Fly   383 YMKVISMSYQFFALLRT 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 86/356 (24%)
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 83/345 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465318
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.