DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or67b

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:317 Identity:62/317 - (19%)
Similarity:123/317 - (38%) Gaps:72/317 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 SAGFFTCTTYNLKPILIAMILYLQNRY---EDFVWFTPFNMTMPKVLLNY---PFFPLTYIF--- 197
            |.|.|.......|.:|.::.|.|.|.:   :..|.|....:.||  :|.|   |:|  .|||   
  Fly   119 SLGLFQLDLPRKKELLSSVSLILLNNWMIIDRQVMFFFKIVCMP--VLYYCVRPYF--QYIFDCY 179

  Fly   198 ----------IAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQA----------EIESMFRPYT 242
                      :.|...|.....|.     :||.:::...| :||:          ...|:|...|
  Fly   180 IKDKDTCEMTLTYPAIVPYLQLGN-----YEFPSYVIRFF-LLQSGPLWCFFAVFGFNSLFVVLT 238

  Fly   243 DHLE-LSPVQLYILEQKMRSVII---------------------RHNAIIDLTRFFRDRYTIITL 285
            .:.. |..|..::::.....:::                     .||.|.:|.::      ||.:
  Fly   239 RYESGLIKVLRFLVQNSTSDILVPKDQRVKYLQCCVRLFARISSHHNQIENLFKY------IILV 297

  Fly   286 AHFVSAAMV--IGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMF 348
            ...||:.::  :.:.:..:|.:|...:| |:.|.:...|| ::.:|......|...|..|....:
  Fly   298 QCSVSSILICMLLYKISTVLEVGWVWMG-MIMVYFVTIAL-EITLYNVSAQKVESQSELLFHDWY 360

  Fly   349 SCPWQLFKPKQRRLVQLLILRSQRPVSMAV-PFFSPSLATFAAILQTSGSIIALVKS 404
            :|.|.....:.:.::::::|.|:|...::| .|.|.|......:.:.|.:...|:::
  Fly   361 NCSWYNESREFKFMIKMMLLFSRRTFVLSVGGFTSLSHKFLVQVFRLSANFFLLLRN 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 60/307 (20%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 39/224 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.