DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or63a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:371 Identity:81/371 - (21%)
Similarity:149/371 - (40%) Gaps:79/371 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 AGTSAVTLLKMFLMLRFRQDLSIMWNRL--------------------RGLLFDPNWERPEQRDI 125
            |||:          |:|...::.||..|                    :..||:...:.|..::|
  Fly    78 AGTA----------LQFLTSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEI 132

  Fly   126 RLKHSAMAARINFW-----PLSAGFFTC----TTYNLKPILIAMILYLQNRYEDFVWFT----PF 177
            |.:..:...|  :|     .:....::|    |.|.:...:|.:..|          ||    .:
  Fly   133 RQQVESTMNR--YWASTRRQILIYLYSCICITTNYFINSFVINLYRY----------FTKPKGSY 185

  Fly   178 NMTMPKVLLNYPF-------FPLTYIFIAYTGYVTIFMFGGC----DGFYFEFCAHLSALFEVLQ 231
            ::.:|...| ||.       ||..:|.: |....::::.|.|    ||.:...|.|...|...|.
  Fly   186 DIMLPLPSL-YPAWEHKGLEFPYYHIQM-YLETCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLN 248

  Fly   232 AEIESMFRPYTDHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIG 296
            ..:|....      ||.|....:  :.:|..|.::..:.:......:.:..||...|:.:....|
  Fly   249 QMVEQATS------ELVPPDRRV--EYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWG 305

  Fly   297 FSMVNL-LTLGNNGLGAMLYVA-YTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQ 359
            .::..: :.||||....|:.:. |.|||..|::||||.|...|.:|..:..|.:...|.....:.
  Fly   306 LALFQMSVGLGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREF 370

  Fly   360 RRLVQLLILRSQRPVSMAVPFF-SPSLATFAAILQTSGSIIALVKS 404
            |.|::::::|:.|...:.|.:| ..||.|..|:::|||....|:::
  Fly   371 RHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQN 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 78/361 (22%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 78/361 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435211
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.