DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or59b

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster


Alignment Length:260 Identity:54/260 - (20%)
Similarity:104/260 - (40%) Gaps:52/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 NYPFFPLTYIFIAYTG--YVTIFMFG------------GCDGF-------YFEFCAHLSALFEVL 230
            ||.|...::|:..|.|  :::..:.|            ..||.       .||:   ::..|.||
  Fly   139 NYAFLIYSFIYCGYAGSTFLSYALSGRPPWSVYNPFIDWRDGMGSLWIQAIFEY---ITMSFAVL 200

  Fly   231 QAEIES--------MFRPY----TDHL-------ELSPVQLYILEQKMRSVIIRHNAIIDLTRFF 276
            |.::..        |||.:    .||:       |.|....|   |.:.:.::.|..|:......
  Fly   201 QDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADNY---QDLVNCVLDHKTILKCCDMI 262

  Fly   277 RDRYTIITLAHFVSAAMVIGFSMVNLLTLGN--NGLGAMLYVAYTVAALSQLLVYCYGGTLVAES 339
            |...:......|.....|:|.::||:....|  .|:.::|:|   :..|.|...:||...::.:.
  Fly   263 RPMISRTIFVQFALIGSVLGLTLVNVFFFSNFWKGVASLLFV---ITILLQTFPFCYTCNMLIDD 324

  Fly   340 STGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRP-VSMAVPFFSPSLATFAAILQTSGSIIALVK 403
            :..|...:|...|...:|:.:..:.|.:...|:| :.:|...|..|:.:...:.:.:.|||.:|:
  Fly   325 AQDLSNEIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFSIITIVR 389

  Fly   404  403
              Fly   390  389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 50/251 (20%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 50/251 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.