DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or59a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster


Alignment Length:400 Identity:74/400 - (18%)
Similarity:140/400 - (35%) Gaps:81/400 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 WPWRSLIHFAI---------------LAIGVATELHAGMCFLDRQQITLALETLCPAGTSAVTLL 89
            |.:..:.||.:               |.:.:...:|.|:.....:.||..:..|....|.....:
  Fly    19 WRYLGVAHFRVENWKNLYVFYSIVSNLLVTLCYPVHLGISLFRNRTITEDILNLTTFATCTACSV 83

  Fly    90 KMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPLSAGFFTCTTYNLK 154
            |..|.....:|:..|...||  |.|.....||||.|                         |...
  Fly    84 KCLLYAYNIKDVLEMERLLR--LLDERVVGPEQRSI-------------------------YGQV 121

  Fly   155 PILIAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPLTYIF-----IAYTGYVTIFMFGGCDG 214
            .:.:..:||:      |:     .:.||..|    |..|:::|     :.|..:...........
  Fly   122 RVQLRNVLYV------FI-----GIYMPCAL----FAELSFLFKEERGLMYPAWFPFDWLHSTRN 171

  Fly   215 FYFEFCAHLSAL-FEVLQAEIESMFRP-----YTDHLE----------LSPVQLYILEQKMRSVI 263
            :|......:..: |::||..:...|..     .:.|::          |.|.:  ..|:.:.:.|
  Fly   172 YYIANAYQIVGISFQLLQNYVSDCFPAVVLCLISSHIKMLYNRFEEVGLDPAR--DAEKDLEACI 234

  Fly   264 IRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLV 328
            ..|..|::|.|......::..|..|...|:.:...:..|:...:..:..|.::.|::|...|:..
  Fly   235 TDHKHILELFRRIEAFISLPMLIQFTVTALNVCIGLAALVFFVSEPMARMYFIFYSLAMPLQIFP 299

  Fly   329 YCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRS-QRPVSMAVPFFSPSLATFAAIL 392
            .|:.||........|..|.|||.|.......:|.:.|.:.:| ::..::|.......|.||.:.|
  Fly   300 SCFFGTDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQSLKKSTAVAGGMMRIHLDTFFSTL 364

  Fly   393 QTSGSIIALV 402
            :.:.|:..::
  Fly   365 KGAYSLFTII 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 67/347 (19%)
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 67/347 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465113
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.