DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or56a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:425 Identity:87/425 - (20%)
Similarity:156/425 - (36%) Gaps:89/425 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GYWPGKTGDTWPWRSLIHFAILAIGVATELHAGMCFLDRQQITLALETLCPAGTSAVTLLKMFLM 94
            ||...|..:. |..|||...||...:...     |.|...::....|.|....||..|.::.|.:
  Fly    30 GYVASKDQNR-PLLSLIRCTILTASIWLS-----CALMLARVFRGYENLNDGATSYATAVQYFAV 88

  Fly    95 LRFRQDLSIMWNRLRGLLFDPNWERPEQRDIR-LKHSAMAARINFWPLSAGFF-TCTTYNLKPIL 157
            .....:..:..:::..||      |....||: |.|.|....:.....:..:. |.|.....|.:
  Fly    89 SIAMFNAYVQRDKVISLL------RVAHSDIQNLMHEADNREMELLVATQAYTRTITLLIWIPSV 147

  Fly   158 IAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPF------FPLTYIFIAYTGYVTIFMFGG-CDGF 215
            ||.::    .|.|.::.:.|   :||.:.|.|.      .|:...        .:|.||. ||.|
  Fly   148 IAGLM----AYSDCIYRSLF---LPKSVFNVPAVRRGEEHPILLF--------QLFPFGELCDNF 197

  Fly   216 YFEFCAHLSAL------------------------FEVLQAEIESM-----------FRPYTDHL 245
            ...:.....||                        .::|...:|.|           .|.....|
  Fly   198 VVGYLGPWYALGLGITAIPLWHTFITCLMKYVNLKLQILNKRVEEMDITRLNSKLVIGRLTASEL 262

  Fly   246 ELSPVQLY--ILEQKMRSVIIRHNAIIDLTRFFRDRYTII---TLAHFVSAAMVIGFSMVNLLTL 305
            ....:||:  .:::::|           :.:|.::...:|   .:|.|:..:::|.| :...||:
  Fly   263 TFWQMQLFKEFVKEQLR-----------IRKFVQELQYLICVPVMADFIIFSVLICF-LFFALTV 315

  Fly   306 G-NNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILR 369
            | .:.:.......|.......|.:|.:..||:.|....|..|.|||.|..|:...::::..:::.
  Fly   316 GVPSKMDYFFMFIYLFVMAGILWIYHWHATLIVECHDELSLAYFSCGWYNFEMPLQKMLVFMMMH 380

  Fly   370 SQRPVSMAVPFFSPSLATFAAILQTSGSIIALVKS 404
            :|||:.|.......:|.||..|.:.:.|...|::|
  Fly   381 AQRPMKMRALLVDLNLRTFIDIGRGAYSYFNLLRS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 73/375 (19%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 59/307 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.