DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or47b

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster


Alignment Length:425 Identity:81/425 - (19%)
Similarity:157/425 - (36%) Gaps:89/425 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VPRLS-------LDIMGYWPGKTGDTWPWRSLIHFAILAIGVATELHAGMCFLDRQQITLAL-ET 77
            :|||:       |.::..:|.|...:.|....|:..|:. .|.|........|...:..:.: :.
  Fly    32 IPRLAFYYVRAFLSLLCQYPNKKLASLPLYRWINLFIMC-NVMTIFWTMFVALPESKNVIEMGDD 95

  Fly    78 LCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPLS 142
            |......|:...|:|.|       .:..:.:..|:.|..:...|.|...:....:..:...:.:.
  Fly    96 LVWISGMALVFTKIFYM-------HLRCDEIDELISDFEYYNRELRPHNIDEEVLGWQRLCYVIE 153

  Fly   143 AG----------FFTCTTYNLKPILIAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPLTYIF 197
            :|          ||:...: |:|:|....|             ||:...|.........|.|:.|
  Fly   154 SGLYINCFCLVNFFSAAIF-LQPLLGEGKL-------------PFHSVYPFQWHRLDLHPYTFWF 204

  Fly   198 IAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIE--SMFRPYTDHLELSPVQLYIL----- 255
            :                :.::.......|..:|..::.  |.|.....:|:|..:::..|     
  Fly   205 L----------------YIWQSLTSQHNLMSILMVDMVGISTFLQTALNLKLLCIEIRKLGDMEV 253

  Fly   256 -----EQKMRSVIIRHNAIIDL----TRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLG 311
                 .::...|:..|..||.|    .|.|...:         :|.::..||::::.|.......
  Fly   254 SDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAF---------NAQLMASFSLISISTFETMAAA 309

  Fly   312 AM------LYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSC-PWQLFKPKQRRLVQLLILR 369
            |:      .:|...:.|..||.::|..||||...|..:.:|.|.. .|....|..:|.:..:|||
  Fly   310 AVDPKMAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVILR 374

  Fly   370 SQRPVS-MAVPFFSPSLATFAAILQTSGSIIALVK 403
            :|:|:. :|.||...:|.|:..:|:....::||::
  Fly   375 AQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQ 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 67/360 (19%)
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 67/359 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435228
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.