DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or47a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster


Alignment Length:414 Identity:80/414 - (19%)
Similarity:168/414 - (40%) Gaps:59/414 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FFAVPRLSLDIMGY-WPGKTGDTW--PWRSLIHFAILAIG---VATELHAGMCFLDRQQITLALE 76
            |..|.:.::.::|: ...:..:.|  |:|::..|:|.||.   :|..||      :.:.:.|..:
  Fly     4 FLQVQKSTIALLGFDLFSENREMWKRPYRAMNVFSIAAIFPFILAAVLH------NWKNVLLLAD 62

  Fly    77 TLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPL 141
            .:.....:.:.|.|..::|..|:|...:.::.|.|:.:...:..|..:|     ..||......:
  Fly    63 AMVALLITILGLFKFSMILYLRRDFKRLIDKFRLLMSNEAEQGEEYAEI-----LNAANKQDQRM 122

  Fly   142 SAGFFTC--TTYNLKPIL----IAMILYLQNRYE---DFVWFTPFNMTMPKVLLNYPFFPLTYIF 197
            ...|.||  ..:.|..:|    :.:..:|....|   .|....|:|:   .::.||   .|::|:
  Fly   123 CTLFRTCFLLAWALNSVLPLVRMGLSYWLAGHAEPELPFPCLFPWNI---HIIRNY---VLSFIW 181

  Fly   198 IAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYILEQKMRSV 262
            .|:.....:......|..:..|.::|.|.|::.|.::          :......|...:..:..|
  Fly   182 SAFASTGVVLPAVSLDTIFCSFTSNLCAFFKIAQYKV----------VRFKGGSLKESQATLNKV 236

  Fly   263 IIRHNAIIDLTRFFRDRYTIITLAHFVSAAM---VIG--FSMVNLLTLGNNGLGAMLYVAYTVAA 322
            ...:...:|:.......|..|..|.|..:::   ::|  ||:....|.|      :.|.::....
  Fly   237 FALYQTSLDMCNDLNQCYQPIICAQFFISSLQLCMLGYLFSITFAQTEG------VYYASFIATI 295

  Fly   323 LSQLLVYCYGGTLVAESSTGLCRAMFSCPWQL------FKPKQRRLVQLLILRSQRPVSMAVPFF 381
            :.|..:|||.|..:...|.....|::..||..      ......|.:.:.::|:.|...:...||
  Fly   296 IIQAYIYCYCGENLKTESASFEWAIYDSPWHESLGAGGASTSICRSLLISMMRAHRGFRITGYFF 360

  Fly   382 SPSLATFAAILQTSGSIIALVKSF 405
            ..::..|::|::|:.|.|.:::||
  Fly   361 EANMEAFSSIVRTAMSYITMLRSF 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 63/345 (18%)
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 63/345 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465050
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26277
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.