DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or45b

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:408 Identity:124/408 - (30%)
Similarity:207/408 - (50%) Gaps:26/408 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RFLKRDQQLDVYFFAVPRLSLDIMGYWPGKTGDTWPWRSLI----HFAILAIGVATELHAGMCFL 66
            |||.|:..|..:.|.|.|.|..::|.   :.|....|..|:    :|..||.....|...|...|
  Fly     4 RFLSRNYPLAKHLFFVTRYSFGLLGL---RFGKEQSWLHLLWLVFNFVNLAHCCQAEFVFGWSHL 65

  Fly    67 DRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLK--- 128
            ....:. |::..||...|..||.|:..|...||:::.:.:|:|.|:    .|:.::.|.|.|   
  Fly    66 RTSPVD-AMDAFCPLACSFTTLFKLGWMWWRRQEVADLMDRIRLLI----GEQEKREDSRRKVAQ 125

  Fly   129 --HSAMAARINFWPLSAGFFTCTTYNLKPILIAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFF 191
              :..|..|......:.|..|...:.|:.:....:    .|:::|.:..||.|.........|:|
  Fly   126 RSYYLMVTRCGMLVFTLGSITTGAFVLRSLWEMWV----RRHQEFKFDMPFRMLFHDFAHRMPWF 186

  Fly   192 PLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYILE 256
            |:.|::..::|.||::.|.|.|||:|.|..:::.|.:.|:.:|:...:|..|.   |..:..|..
  Fly   187 PVFYLYSTWSGQVTVYAFAGTDGFFFGFTLYMAFLLQALRYDIQDALKPIRDP---SLRESKICC 248

  Fly   257 QKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVA 321
            |::..::.|||.|..:.:.|.......|..|||||::||..|::::|..  :|...:.||.||..
  Fly   249 QRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLY--SGYNIIRYVVYTFT 311

  Fly   322 ALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVPFFSPSLA 386
            ..|.:.:||||||.::..|..|..|.:|..|..:..:.||.|.|:|||:|||:::.||||:|||.
  Fly   312 VSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRVPFFAPSLP 376

  Fly   387 TFAAILQTSGSIIALVKS 404
            .|.::::.:|||:||.|:
  Fly   377 VFTSVIKFTGSIVALAKT 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 99/330 (30%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 99/331 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435205
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119597
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26277
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014265
OrthoInspector 1 1.000 - - mtm9641
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.