DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or45a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster


Alignment Length:438 Identity:95/438 - (21%)
Similarity:170/438 - (38%) Gaps:106/438 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LDVYFFAVPRLSLDIMGYWPGKTGDTWPWRSLIHFAILAIGVATELHAGMCFL------------ 66
            :|..:|||.|.:|:|:|:.|     :.|..||.|          .:.||:..|            
  Fly     1 MDASYFAVQRRALEIVGFDP-----STPQLSLKH----------PIWAGILILSLISHNWPMVVY 50

  Fly    67 ---DRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGL----LFDPNW----ERP 120
               |...:|...:........:.:..|..:|:..|:.:..:.:||..|    ...||.    ||.
  Fly    51 ALQDLSDLTRLTDNFAVFMQGSQSTFKFLVMMAKRRRIGSLIHRLHKLNQAASATPNHLEKIERE 115

  Fly   121 EQRDIRLKHSAMAARINFWPLSAGFFTCTTYNLKPILIAMILYLQNRYEDFVWFTP-----FNMT 180
            .|.|   ::.|.:.|      :|.:.......:.|:|:.:..|::...     |||     ||..
  Fly   116 NQLD---RYVARSFR------NAAYGVICASAIAPMLLGLWGYVETGV-----FTPTTPMEFNFW 166

  Fly   181 MP--KVLLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTD 243
            :.  |....:|.:....:.:|...::.|               ....||..|...:...|:    
  Fly   167 LDERKPHFYWPIYVWGVLGVAAAAWLAI---------------ATDTLFSWLTHNVVIQFQ---- 212

  Fly   244 HLELSPVQLYILEQK--------MRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMV 300
            .|||      :||:|        :...:.||...:||.:.....:..|....::       .|.:
  Fly   213 LLEL------VLEEKDLNGGDSRLTGFVSRHRIALDLAKELSSIFGEIVFVKYM-------LSYL 264

  Fly   301 NLLTL----GNNGLGAML--YVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMF-SCPWQLFKPK 358
            .|..|    ..:|..|.:  ...:.||.:.||..|||||..:.:.|..:.:|:: ...|....||
  Fly   265 QLCMLAFRFSRSGWSAQVPFRATFLVAIIIQLSSYCYGGEYIKQQSLAIAQAVYGQINWPEMTPK 329

  Fly   359 QRRLVQLLILRSQRPVSMAVPFFSPSLATFAAILQTSGSIIALVKSFQ 406
            :|||.|::|:|:|||..:....|...|.....:::|:||.:|::::|:
  Fly   330 KRRLWQMVIMRAQRPAKIFGFMFVVDLPLLLWVIRTAGSFLAMLRTFE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 74/355 (21%)
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 73/348 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.