DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or43a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster


Alignment Length:441 Identity:84/441 - (19%)
Similarity:160/441 - (36%) Gaps:136/441 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEWLRFLKRDQQLDVYFFAVPRLSLDIMGY------WPGKTGDTWPWRSLIHFAILAIGVATELH 60
            |.|.:|.          |.:|..::::|.:      |    ||. |...|..|...||..|. :.
  Fly    28 SSWRKFA----------FVLPVTAMNLMQFVYLLRMW----GDL-PAFILNMFFFSAIFNAL-MR 76

  Fly    61 AGMCFLDRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDI 125
            ..:..:.|:|....|..|       .||....|      |.:..|.  ||:|      |..:|:.
  Fly    77 TWLVIIKRRQFEEFLGQL-------ATLFHSIL------DSTDEWG--RGIL------RRAEREA 120

  Fly   126 RLKHSAMAARINFWPLSAGFFTCTTYNLKPILIAMILYLQNRYEDFVWFTPFNMTMPKV-LLNYP 189
            |     ..|.:|   |||.|.......:.|      |:.:.|..      ||.:.:|.| :.:.|
  Fly   121 R-----NLAILN---LSASFLDIVGALVSP------LFREERAH------PFGLALPGVSMTSSP 165

  Fly   190 FFPLTY---------IFIAYTGYVTIF----MFGGCDGFYFEFCAHLSALFEVL----------- 230
            .:.:.|         :.:.|..:|::|    :||             .|:.::|           
  Fly   166 VYEVIYLAQLPTPLLLSMMYMPFVSLFAGLAIFG-------------KAMLQILVHRLGQIGGEE 217

  Fly   231 QAEIESMFRPYTDHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVI 295
            |:|.|..                   |::.|.|..|..::   |:......::  |:.|:...:|
  Fly   218 QSEEERF-------------------QRLASCIAYHTQVM---RYVWQLNKLV--ANIVAVEAII 258

  Fly   296 GFSMV-------NLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQ 353
            ..|::       |::|.....:..::|:   :..|..|..|......:...:..:..|:::.||.
  Fly   259 FGSIICSLLFCLNIITSPTQVISIVMYI---LTMLYVLFTYYNRANEICLENNRVAEAVYNVPWY 320

  Fly   354 LFKPKQRRLVQLLILRSQRPVSMAVPFFSP-SLATFAAILQTSGSIIALVK 403
            ....:.|:.:.:.::::|.|:.:.|....| :||.|.::|..|.|...:::
  Fly   321 EAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASYSYFTMLR 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 66/358 (18%)
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 74/390 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465279
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.