DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or42b

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:457 Identity:95/457 - (20%)
Similarity:166/457 - (36%) Gaps:145/457 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KRDQQLDVYFFAVPRLSLDIMGYWPGKTGD------TWPWRSLIHFAILAIGVATELHAGMCFLD 67
            ||.:...:|.:.    ::..:|:.|.|.|.      ||   :|:.|    :...|.|..|  ||.
  Fly    15 KRSRDGCIYLYR----AMKFIGWLPPKQGVLRYVYLTW---TLMTF----VWCTTYLPLG--FLG 66

  Fly    68 RQQITLALETLCPAGTSAVTLLKMFLMLRFRQDL-----------------SIMWN--RLRGLLF 113
                            |.:|.:|.|....|...|                 |::|.  :.:.:| 
  Fly    67 ----------------SYMTQIKSFSPGEFLTSLQVCINAYGSSVKVAITYSMLWRLIKAKNIL- 114

  Fly   114 DPNWERPEQRDIRL-------KHSAMAARINFWPLSAGFFTC----TTYNLKPILIAMIL----- 162
                   :|.|:|.       |...:.||.|...|...|..|    :||      ::.:|     
  Fly   115 -------DQLDLRCTAMEEREKIHLVVARSNHAFLIFTFVYCGYAGSTY------LSSVLSGRPP 166

  Fly   163 -YLQNRYEDF------VWF--TPFNMTMPKVLLNYPF---FPLTYIFIAYTGYVTIFMFGGCDGF 215
             .|.|.:.|:      :|.  |...|.|...:|....   :||.|..|                 
  Fly   167 WQLYNPFIDWHDGTLKLWVASTLEYMVMSGAVLQDQLSDSYPLIYTLI----------------- 214

  Fly   216 YFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLY------ILEQKMRSVIIRHNAIIDLTR 274
               ..|||..|.|.::       |..:|. .||..:.|      :::.|:   |:|:.|||... 
  Fly   215 ---LRAHLDMLRERIR-------RLRSDE-NLSEAESYEELVKCVMDHKL---ILRYCAIIKPV- 264

  Fly   275 FFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGN--NGLGAMLYVAYTVAALSQLLVYCYGGTLVA 337
               .:.||.|  .|:...:|:||:::|:....:  .|:.:.::|   :..|.|...:||...|:.
  Fly   265 ---IQGTIFT--QFLLIGLVLGFTLINVFFFSDIWTGIASFMFV---ITILLQTFPFCYTCNLIM 321

  Fly   338 ESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRP-VSMAVPFFSPSLATFAAILQTSGSIIAL 401
            |....|..|:|...|.....:.:..:...:...|:| |.:|...|..|:::..::.:.:.|:|.:
  Fly   322 EDCESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITI 386

  Fly   402 VK 403
            .|
  Fly   387 TK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 76/381 (20%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 72/358 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.