DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or42a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster


Alignment Length:335 Identity:71/335 - (21%)
Similarity:126/335 - (37%) Gaps:55/335 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPLSAGFFTC 148
            |...|:...|:.||.:..::: :.:...:.||.......|.:.|.:     ||.|:.::......
  Fly    97 STKVLIVWALVKRFDEANNLL-DEMDRRITDPGERLQIHRAVSLSN-----RIFFFFMAVYMVYA 155

  Fly   149 TTYNLKPILIAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPLTYIFIAYTGYVTIFMFGGC- 212
            |...|..|.|....| ||.|....|.:.                 |.......|.....|.|.| 
  Fly   156 TNTFLSAIFIGRPPY-QNYYPFLDWRSS-----------------TLHLALQAGLEYFAMAGACF 202

  Fly   213 -----DGFYFEFC----AHLSALFEVLQAEIESMFR----PYTDHLELSPVQLYILEQKMRSVII 264
                 |.:...|.    ||:|...|.|:       |    ||.     |..|.|   :::...|.
  Fly   203 QDVCVDCYPVNFVLVLRAHMSIFAERLR-------RLGTYPYE-----SQEQKY---ERLVQCIQ 252

  Fly   265 RHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVY 329
            .|..|:......|...:......|:...:|:||:::|::...|.| .|:..:::..|.|.:...:
  Fly   253 DHKVILRFVDCLRPVISGTIFVQFLVVGLVLGFTLINIVLFANLG-SAIAALSFMAAVLLETTPF 316

  Fly   330 CYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVS-MAVPFFSPSLATFAAILQ 393
            |.....:.|....|..|:|...|...:.:.::.:...:.:.|:|:: ||:..|..|:.|..::.:
  Fly   317 CILCNYLTEDCYKLADALFQSNWIDEEKRYQKTLMYFLQKLQQPITFMAMNVFPISVGTNISVTK 381

  Fly   394 TSGSIIALVK 403
            .|.|:..|||
  Fly   382 FSFSVFTLVK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 66/326 (20%)
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 66/326 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465121
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.