DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or33b

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster


Alignment Length:322 Identity:64/322 - (19%)
Similarity:119/322 - (36%) Gaps:75/322 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KMFLMLRFRQDLSIMWNRLRG----LLFDPNWERPEQRDIRLKHSAMAARINFWPLSAGFFTCTT 150
            |.|::.....::|.:.:.|.|    ||: |.|         ..:...|..:.|| ||      .|
  Fly   128 KSFIVAYGLSNISAIASVLFGGGHKLLY-PAW---------FPYDVQATELIFW-LS------VT 175

  Fly   151 YNLKPILIAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPLTYIFIAYTGYVTIFMFGGCDGF 215
            |.:..:.:|:   |||...|                :||  |:|:..:|  |:|.:...      
  Fly   176 YQIAGVSLAI---LQNLAND----------------SYP--PMTFCVVA--GHVRLLAM------ 211

  Fly   216 YFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRY 280
                     .|..:.|...|:               :|:..:::...|..|..::.:....|...
  Fly   212 ---------RLSRIGQGPEET---------------IYLTGKQLIESIEDHRKLMKIVELLRSTM 252

  Fly   281 TIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCR 345
            .|..|..|:|:.:.|..::||:|...:|......|..|.::.:.:|...||.|||::.....|..
  Fly   253 NISQLGQFISSGVNISITLVNILFFADNNFAITYYGVYFLSMVLELFPCCYYGTLISVEMNQLTY 317

  Fly   346 AMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-AVPFFSPSLATFAAILQTSGSIIALVKSFQ 406
            |::|..|........|::.:.:..:...|.: |.......:..|.|.::.:.|...|..|.:
  Fly   318 AIYSSNWMSMNRSYSRILLIFMQLTLAEVQIKAGGMIGIGMNAFFATVRLAYSFFTLAMSLR 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 61/310 (20%)
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 61/310 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465115
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.