DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or33a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster


Alignment Length:402 Identity:84/402 - (20%)
Similarity:154/402 - (38%) Gaps:69/402 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YWP--GKTGDTWPWRSLIHFAILA-IGVATELHAGMCFLDRQQI----TLALETLCPAGTSAVTL 88
            ||.  |..|| :|:|.|:.|.|.: |.:...:|..:....:.||    :|...:.|        |
  Fly    19 YWRLLGVEGD-YPFRRLVDFTITSFITILFPVHLILGMYKKPQIQVFRSLHFTSEC--------L 74

  Fly    89 LKMFLMLRFRQDLSIMWNRLRGLL--FDPNWERPEQRDIRLKHSAMAARINFWPLSAGFFTCTTY 151
            ...:....||..|..: ..:.|||  .|...|..|:|:...::.:..||:    ||..:....  
  Fly    75 FCSYKFFCFRWKLKEI-KTIEGLLQDLDSRVESEEERNYFNQNPSRVARM----LSKSYLVAA-- 132

  Fly   152 NLKPILIAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFY 216
             :..|:.|.:..|              .:..:.|:...:||..:...|...:::           
  Fly   133 -ISAIITATVAGL--------------FSTGRNLMYLGWFPYDFQATAAIYWIS----------- 171

  Fly   217 FEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYILE----------------QKMRSVIIR 265
            |.:.|..|:|. :|:......:.|.|..:....|:|.|:.                :|:...|..
  Fly   172 FSYQAIGSSLL-ILENLANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQD 235

  Fly   266 HNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYC 330
            |..::.:.|..|....:..|..|:|:.:.|..:::|:|....|....:.|..:..|.|.:|...|
  Fly   236 HRKLMKIIRLLRSTLHLSQLGQFLSSGINISITLINILFFAENNFAMLYYAVFFAAMLIELFPSC 300

  Fly   331 YGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-AVPFFSPSLATFAAILQT 394
            |.|.|:......|..|:||..|.....:..|.:.:|:..:..||:: |.......::.|.|.::.
  Fly   301 YYGILMTMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRM 365

  Fly   395 SGSIIALVKSFQ 406
            :.|...|..||:
  Fly   366 AYSFYTLALSFR 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 68/348 (20%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 67/347 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465116
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.