DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or30a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523520.2 Gene:Or30a / 34236 FlyBaseID:FBgn0032096 Length:377 Species:Drosophila melanogaster


Alignment Length:396 Identity:84/396 - (21%)
Similarity:141/396 - (35%) Gaps:128/396 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 FRQDLSIM--WNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPLSAGFFTCTTYNLKPILIA 159
            |...|.:|  |:    .||..||.|         :.||...|        ...||.|        
  Fly    14 FGSTLKLMKFWS----YLFVHNWRR---------YVAMTPYI--------IINCTQY-------- 49

  Fly   160 MILYLQNRYEDF--------VWFTPFNMTMPKVLL-----NYPFF----------------PLTY 195
            :.:||.....||        |.||  |..:..|||     :|..|                |:..
  Fly    50 VDIYLSTESLDFIIRNVYLAVLFT--NTVVRGVLLCVQRFSYERFINILKSFYIELLQSDDPIIN 112

  Fly   196 IFIAYT--------------------GYVTIFMFGG----CDGFY------FEFCAHLSALFEVL 230
            |.:..|                    |:||..:||.    ..|.|      :::.:....:|.|:
  Fly   113 ILVKETTRLSVLISRINLLMGCCTCIGFVTYPIFGSERVLPYGMYLPTIDEYKYASPYYEIFFVI 177

  Fly   231 QAEIE----SMFRPYTDHLE----LSPVQLYILEQKMRSV------IIRHNAI------IDLTRF 275
            ||.:.    .|:.|||:.:.    .:.:...:|:.|:||:      .:|...|      :.|:.|
  Fly   178 QAIMAPMGCCMYIPYTNMVVTFTLFAILMCRVLQHKLRSLEKLKNEQVRGEIIWCIKYQLKLSGF 242

  Fly   276 FRDRYTIITLAHFVS----AAM--VIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGT 334
            ......:.|..|.|.    .||  |:.||::...|:..    .::.:||.|...:..:|..|...
  Fly   243 VDSMNALNTHLHLVEFLCFGAMLCVLLFSLIIAQTIAQ----TVIVIAYMVMIFANSVVLYYVAN 303

  Fly   335 LVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVPFFSPSLATFAAILQTSGSII 399
            .:...|..:..|.:...|..|....::.::.||:|||:|:::.|.      .|:...|:...|::
  Fly   304 ELYFQSFDIAIAAYESNWMDFDVDTQKTLKFLIMRSQKPLAILVG------GTYPMNLKMLQSLL 362

  Fly   400 ALVKSF 405
            ..:.||
  Fly   363 NAIYSF 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 81/385 (21%)
Or30aNP_523520.2 7tm_6 58..366 CDD:251636 65/319 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.