DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or24a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:407 Identity:131/407 - (32%)
Similarity:232/407 - (57%) Gaps:22/407 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RFLKRDQQLDVYFFAVPRLSLDIMGYWPGKTGDT----WPWRSLIHFAILAIGVATELHAGMCFL 66
            |||.....::.::|.||:.:|.::|::|.:....    |   |..:|.||..|...|.:.|:.::
  Fly     4 RFLTASYPMERHYFMVPKFALSLIGFYPEQKRTVLVKLW---SFFNFFILTYGCYAEAYYGIHYI 65

  Fly    67 DRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHS- 130
            . ..|..||:.|||..:|.::|:||..:..::.:|..:..|:|.|    ..::..:|.:..|.. 
  Fly    66 P-INIATALDALCPVASSILSLVKMVAIWWYQDELRSLIERVRFL----TEQQKSKRKLGYKKRF 125

  Fly   131 -AMAARINFWPLSAGFFTCTTYNLKPILIAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPLT 194
             .:|.::.|..|..||.|.|:|:::. ||..|| .:...:|:::.|||.|..|.:||..|.:|:|
  Fly   126 YTLATQLTFLLLCCGFCTSTSYSVRH-LIDNIL-RRTHGKDWIYETPFKMMFPDLLLRLPLYPIT 188

  Fly   195 YIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSP--VQLYILEQ 257
            ||.:.:.||:|:..|.|.|||:..||.:.:.|...||.::..:..  .:::|.||  .:...:.:
  Fly   189 YILVHWHGYITVVCFVGADGFFLGFCLYFTVLLLCLQDDVCDLLE--VENIEKSPSEAEEARIVR 251

  Fly   258 KMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAA 322
            :|..::.|||.:.:||.........|||||||:::::||.|:|::|..  :|||.::||.||.|.
  Fly   252 EMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLF--SGLGIIVYVVYTCAV 314

  Fly   323 LSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVPFFSPSLAT 387
            ..::.:||.||:.:.|:.:.|.|:.||..|.....:.:::..|::.|:||.:::.:|||||||.|
  Fly   315 GVEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQKMTLLMVARAQRVLTIKIPFFSPSLET 379

  Fly   388 FAAILQTSGSIIALVKS 404
            ..:||:.:||:|||.||
  Fly   380 LTSILRFTGSLIALAKS 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 107/329 (33%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 107/329 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435207
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119597
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26277
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014265
OrthoInspector 1 1.000 - - mtm9641
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.