DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or23a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523458.3 Gene:Or23a / 33450 FlyBaseID:FBgn0026395 Length:379 Species:Drosophila melanogaster


Alignment Length:443 Identity:90/443 - (20%)
Similarity:153/443 - (34%) Gaps:120/443 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKRDQQLDVYFFAVPRLSLDIMGYWPGKTGDTWPWRSLIHFAILAIGVATELHAGM-CFLD--RQ 69
            :|..:.|.:.:|.|...:..|.|......|..|.|..|:  .||.......|..|: .|.|  ..
  Fly     1 MKLSETLKIDYFRVQLNAWRICGALDLSEGRYWSWSMLL--CILVYLPTPMLLRGVYSFEDPVEN 63

  Fly    70 QITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAA 134
            ..:|:|..     ||...|:| |.|...:....:....|.|           |.|.|:...:.:.
  Fly    64 NFSLSLTV-----TSLSNLMK-FCMYVAQLTKMVEVQSLIG-----------QLDARVSGESQSE 111

  Fly   135 RINFWPLSAGFFTCTTYNLKPILIAMILYLQNRYE--------DFVWFTPFNMTMPKVLLNYPFF 191
            |..              |:...|:.|....|..|.        .||:.|..::.||.      :|
  Fly   112 RHR--------------NMTEHLLRMSKLFQITYAVVFIIAAVPFVFETELSLPMPM------WF 156

  Fly   192 PLTY--IFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYI 254
            |..:  ..:||.| ..:|.             .:..:|:::|......|         .|:.||:
  Fly   157 PFDWKNSMVAYIG-ALVFQ-------------EIGYVFQIMQCFAADSF---------PPLVLYL 198

  Fly   255 LEQKMRSVIIRHNAI-----------IDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNN 308
            :.::.:.:|:|.:.|           .||....||:..:..|.. |:.::|....||..:.:|.|
  Fly   199 ISEQCQLLILRISEIGYGYKTLEENEQDLVNCIRDQNALYRLLD-VTKSLVSYPMMVQFMVIGIN 262

  Fly   309 GLGAMLYVAYTVAALSQLLVY--------------CYGGTLVAESSTGLCRAMFSCPW------- 352
            ....:..:.:.|..|...:.|              ||.||:|.||...|..|:|...|       
  Fly   263 IAITLFVLIFYVETLYDRIYYLCFLLGITVQTYPLCYYGTMVQESFAELHYAVFCSNWVDQSASY 327

  Fly   353 ---QLFKPKQRRLVQLLILRSQRPVSMAVPFFSPSLATFAAILQTSGSIIALV 402
               .|...::.:.:|||:..:..|:         .|:|:.|..:.:.|...|:
  Fly   328 RGHMLILAERTKRMQLLLAGNLVPI---------HLSTYVACWKGAYSFFTLM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 72/370 (19%)
Or23aNP_523458.3 7tm_6 59..365 CDD:251636 73/375 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.