DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or22b

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:397 Identity:76/397 - (19%)
Similarity:151/397 - (38%) Gaps:97/397 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SLIHFAILAIGVATE-------LHAGMCFLDRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDL 101
            :|:.|.:|.|.|:.|       ..||. ||...||.:.:     .|:|..:.|.| :..:.||:.
  Fly    56 TLLIFILLPISVSVEYIQRFKTFSAGE-FLSSIQIGVNM-----YGSSFKSYLTM-MGYKKRQEA 113

  Fly   102 SIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPLSAGFFTCTTYNLKPILIAMILYLQN 166
            .:..:.|     |......|:|.|..:|.|:           |.|....|:     ||...:|.:
  Fly   114 KMSLDEL-----DKRCVCDEERTIVHRHVAL-----------GNFCYIFYH-----IAYTSFLIS 157

  Fly   167 RYEDFV------WFTPFNMTMPKVLLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSA 225
            .:..|:      |    .|..|.|.....|:..:...:...|: .:||         :.|..:..
  Fly   158 NFLSFIMKRIHAW----RMYFPYVDPEKQFYISSIAEVILRGW-AVFM---------DLCTDVCP 208

  Fly   226 LFEVLQAEIESMFRPYTDHLELSPVQLYILEQKMRSV------------------IIRHNAIIDL 272
            |..::.|..         |:.|       |:|::|::                  :..|..|:|.
  Fly   209 LISMVIARC---------HITL-------LKQRLRNLRSEPGRTEDEYLKELADCVRDHRLILDY 257

  Fly   273 TRFFRDRYTIITLAHFVSAAMVIGFSMVNLL---TLGNNGLGAMLYVAYTVAALSQLLVYCYGGT 334
            ....|..::......|:...:|:|.||:|::   || :.|:..:|:::   ....|...:||...
  Fly   258 VDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTL-STGVAVVLFMS---CVSMQTFPFCYLCN 318

  Fly   335 LVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-AVPFFSPSLATFAAILQTSGSI 398
            ::.:....:..::|...|.....:.:..:...:...|:|:.: |...|..|:.|...:::.:.::
  Fly   319 MIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFPISMQTNLNMVKLAFTV 383

  Fly   399 IALVKSF 405
            :.:||.|
  Fly   384 VTIVKQF 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 63/353 (18%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 66/361 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.