DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or22a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster


Alignment Length:411 Identity:77/411 - (18%)
Similarity:161/411 - (39%) Gaps:93/411 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WPGKTGDTW--PWR------SLIHFAILAIGVATE-LH------AGMCFLDRQQITLALETLCPA 81
            |.......|  |::      :::...:|.|.::.| ||      ||. ||...:|.:.:     .
  Fly    36 WTEPENKRWILPYKLWLAFVNIVMLILLPISISIEYLHRFKTFSAGE-FLSSLEIGVNM-----Y 94

  Fly    82 GTS---AVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPLSA 143
            |:|   |.||:.    .:.||:..::.::|     |......::|....::.||.   ||:.   
  Fly    95 GSSFKCAFTLIG----FKKRQEAKVLLDQL-----DKRCLSDKERSTVHRYVAMG---NFFD--- 144

  Fly   144 GFFTCTTYNLKPILIAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPL--TYIFIAYTGYVT- 205
                             |||       .::::.|      |::|:|:|.|  .:.:..|..|:. 
  Fly   145 -----------------ILY-------HIFYSTF------VVMNFPYFLLERRHAWRMYFPYIDS 179

  Fly   206 -----IFMFGGC----DGFYFEFCAHLSALFEVLQAEIE-SMFRPYTDHLELSPVQL---YILEQ 257
                 |.....|    :..|.:.|..:..|..:|.|... |:.:....:|...|.:.   |:  :
  Fly   180 DEQFYISSIAECFLMTEAIYMDLCTDVCPLISMLMARCHISLLKQRLRNLRSKPGRTEDEYL--E 242

  Fly   258 KMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGN--NGLGAMLYVAYTV 320
            ::...|..|..::|.....|..::......|:....|:|.||:||:....  .|:...|:: :.|
  Fly   243 ELTECIRDHRLLLDYVDALRPVFSGTIFVQFLLIGTVLGLSMINLMFFSTFWTGVATCLFM-FDV 306

  Fly   321 AALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-AVPFFSPS 384
            :  .:...:||...::.:....:...:|...|.....:.:..:...:...|:|::: |...|..|
  Fly   307 S--METFPFCYLCNMIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHNLQQPITLTAGGVFPIS 369

  Fly   385 LATFAAILQTSGSIIALVKSF 405
            :.|..|:::.:.|::.::|.|
  Fly   370 MQTNLAMVKLAFSVVTVIKQF 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 62/347 (18%)
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 65/355 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.