DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and AgaP_AGAP003055

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_562811.3 Gene:AgaP_AGAP003055 / 3290734 VectorBaseID:AGAP003055 Length:177 Species:Anopheles gambiae


Alignment Length:186 Identity:37/186 - (19%)
Similarity:77/186 - (41%) Gaps:14/186 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 IFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYILEQKMRSVIIRHNAII 270
            |....|.||...     ||.|..|.|.:   :.:.....|::...|..:..:.:|.:.| |..|.
Mosquito     4 ILFLVGIDGLLV-----LSILAAVHQIK---LLKITIQELDIGAEQAELHRELVRIIQI-HQRIQ 59

  Fly   271 DLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTL 335
            .........|.|..|..|....:::   .:.|..:.:..:.|:.:  :.:|.:.||.:.|:.|.|
Mosquito    60 QFIHQLEQTYYIDLLVDFGLVCLIL---CMGLNVIADEVINAIWF--FLIAVVFQLSLLCFSGNL 119

  Fly   336 VAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVPFFSPSLATFAAI 391
            :...|..|...::|..|......:::|:.::|..:|:|..:...|....:::|.::
Mosquito   120 LLIESDSLSSCVYSIDWHAMPVPEQKLLMVMIAHAQKPQVLRGIFMPLIMSSFLSV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 37/186 (20%)
AgaP_AGAP003055XP_562811.3 7tm_6 <1..175 CDD:251636 37/184 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.