DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or9a

DIOPT Version :9

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:432 Identity:94/432 - (21%)
Similarity:170/432 - (39%) Gaps:88/432 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KRDQQLDVYFFAVPRLSLDIMGYWPGKTGDTWPWRSLIHFAILAIGVATELHAGMCFLDRQQITL 73
            ::||.|.|.......:.:|:   |.....:..||.:.:....|.:.:.....|...::  .|::|
  Fly    12 EKDQSLRVQILVYRCMGIDL---WSPTMANDRPWLTFVTMGPLFLFMVPMFLAAHEYI--TQVSL 71

  Fly    74 ALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINF 138
            ..:||.....|.:||:|..|....|::..       ||::          .||   :.:|..|..
  Fly    72 LSDTLGSTFASMLTLVKFLLFCYHRKEFV-------GLIY----------HIR---AILAKEIEV 116

  Fly   139 WP---------------LSAGFFTCTTYNLKPILIAM-----ILYLQNRYEDFVWFTPFNMTMPK 183
            ||               ||..:..|  :.|..|..|:     |:....|.::.....|.|...|.
  Fly   117 WPDAREIIEVENQSDQMLSLTYTRC--FGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPY 179

  Fly   184 VLLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVL------------QAEIES 236
            .|....|:..||::.....|..:.|....|...|.|..::.|:|::.            :.|:|.
  Fly   180 DLQVVMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAKHRMIHLPAVGGKEELEG 244

  Fly   237 MFRPYTDHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRY-TIITLAHFVSAAMV--IGFS 298
            :            ||:.:|.||.          :.:.....|:| .:|.|..|:||..:  |||.
  Fly   245 L------------VQVLLLHQKG----------LQIADHIADKYRPLIFLQFFLSALQICFIGFQ 287

  Fly   299 MVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLV 363
            :.:|..    ...::.::|:..:.|..|.:|...|..:..:|......::...|..|.|..:|.:
  Fly   288 VADLFP----NPQSLYFIAFVGSLLIALFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRAL 348

  Fly   364 QLLILRSQRPVSMAVPFFSPSLATFAAILQTSGSIIALVKSF 405
            .:..:|:|||..|...||..|:|||:.|::::.|.|.:::||
  Fly   349 LIAAMRAQRPCQMKGYFFEASMATFSTIVRSAVSYIMMLRSF 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 80/360 (22%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 80/360 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26277
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.